TkA02G580410 | RubberDandelionOmics

Gene overview

TkA02G580410

Reference: TK1151 Chr: Chr02 Coordinates: 149734064-149734735 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · TkA02G580410|TK1151|cDNA

ATGGACAATTCAACACTCGATTTCCAGACCTTCTTCCCAGAATGGCTGACCCAATTGGAGCTTTATCTTCACCAGCTTCTCCACCTTCTTCAATCCCCAGACGAGTCCAAACACAAACAACTCATTCGCCGAGTCATGGCTCACTACCACGACTACATCCTTGCCAAGACCCAAGTTTCAAGCCGGAATGTTTTTCTAGTTCTATCGCCACCGTGGCTCAGCTCCTTTGAGCGGACCTTCCTATGGTTAGGTGGGTTTAA...

CDS

Download CDS FASTA

672 bp · TkA02G580410|TK1151|CDS

ATGGACAATTCAACACTCGATTTCCAGACCTTCTTCCCAGAATGGCTGACCCAATTGGAGCTTTATCTTCACCAGCTTCTCCACCTTCTTCAATCCCCAGACGAGTCCAAACACAAACAACTCATTCGCCGAGTCATGGCTCACTACCACGACTACATCCTTGCCAAGACCCAAGTTTCAAGCCGGAATGTTTTTCTAGTTCTATCGCCACCGTGGCTCAGCTCCTTTGAGCGGACCTTCCTATGGTTAGGTGGGTTTAA...

Protein

Download Protein FASTA

223 aa · TkA02G580410|TK1151|PROTEIN

MDNSTLDFQTFFPEWLTQLELYLHQLLHLLQSPDESKHKQLIRRVMAHYHDYILAKTQVSSRNVFLVLSPPWLSSFERTFLWLGGFKPSLALHVAKRCGVELTSDQAERMERLTVETKDDEIAMAERLGRLEVQVLSPAMLALTRMGGREVNGMIDEADIAVEKLAEDMEFLVGCADYLREKTVAKVVGILTTAQTVRFLAGMIQLQLSIRRWGQLREIDGGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G580410`
TK1151 ID	TkA02G580410
OH-1004 ID	LXL04_012226
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G580410

Location Chr02:149734064-149734735 (-)

Description Similar to DOGL4: Protein DOG1-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58330`	May be involved in the regulation of abscisic acid (ABA) sensitivity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012226 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900070 negative regulation of cellular hyperosmotic salinity response Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G09950

ath:AT1G58330

ath:AT4G18650

dosa:Os06g0265400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.505

Rank 1 · TkA02G580410 · TK1151

Cytoplasm0.438

Rank 2 · TkA02G580410 · TK1151

Plastid0.070

Rank 3 · TkA02G580410 · TK1151

Cell membrane0.055

Rank 4 · TkA02G580410 · TK1151

Mitochondrion0.055

Rank 5 · TkA02G580410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14144DOG18-23 aa

PF14144DOG123-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G580410	`PF14144`	DOG1	8	23	6.8e-23	81.4
TkA02G580410	`PF14144`	DOG1	23	94	6.8e-23	81.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLV1`	Arabidopsis thaliana	sp\|Q9SLV1\|ZW2_ARATH Protein ZW2	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card