TkA02G579590 | RubberDandelionOmics

Gene overview

TkA02G579590

Reference: TK1151 Chr: Chr02 Coordinates: 149542961-149543491 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · TkA02G579590|TK1151|cDNA

ATGGATCTAGTGGCCGGTGAATCACTGATCAAAGAGCGAGCTGCCAGCAAGTTTAATGATTTGGTGGGATCGACAACCGCGGCTGCTGGCACGGAGTTAGTCGGGGCTTCTTCCTCGAGTCTTGTCATGATCACGCACTCAACGAAAGAGCTTTACAAGCGGCATTGCCCTTCTTCACTCACGCGATATTGCTGGATCGGGCTTTCGCCCATTGTCCAAGATGCCCCACTGCTGCCCCTCGCGGGAGTCTGGGCCGTGTC...

CDS

Download CDS FASTA

531 bp · TkA02G579590|TK1151|CDS

ATGGATCTAGTGGCCGGTGAATCACTGATCAAAGAGCGAGCTGCCAGCAAGTTTAATGATTTGGTGGGATCGACAACCGCGGCTGCTGGCACGGAGTTAGTCGGGGCTTCTTCCTCGAGTCTTGTCATGATCACGCACTCAACGAAAGAGCTTTACAAGCGGCATTGCCCTTCTTCACTCACGCGATATTGCTGGATCGGGCTTTCGCCCATTGTCCAAGATGCCCCACTGCTGCCCCTCGCGGGAGTCTGGGCCGTGTC...

Protein

Download Protein FASTA

176 aa · TkA02G579590|TK1151|PROTEIN

MDLVAGESLIKERAASKFNDLVGSTTAAAGTELVGASSSSLVMITHSTKELYKRHCPSSLTRYCWIGLSPIVQDAPLLPLAGVWAVSLLTLYMWAPDIYEGSPTPVTAFLSIAPKISISANISRLSIYGSYGATLQQIFFSCSIASMILGALAAMAQTYRSAASAVEEVDDRQKMG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G579590`
TK1151 ID	TkA02G579590
OH-1004 ID	LXL04_040179
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.400
Protein coverage (%)	TK1151 19.318 / OH-1004 3.301 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G579590

Location Chr02:149542961-149543491 (-)

Description Similar to RPL5: 60S ribosomal protein L5, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: O05000`	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_040179 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005762 mitochondrial large ribosomal subunit Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT2G07725

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.417

Rank 1 · TkA02G579590 · TK1151

Endoplasmic reticulum0.181

Rank 2 · TkA02G579590 · TK1151

Nucleus0.136

Rank 3 · TkA02G579590 · TK1151

Golgi apparatus0.118

Rank 4 · TkA02G579590 · TK1151

Cell membrane0.109

Rank 5 · TkA02G579590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00361Proton_antipo_M83-158 aa

PF29522KH_YLL032C_2nd132-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G579590	`PF00361`	Proton_antipo_M	83	158	7.6e-17	62.2
TkA02G579590	`PF29522`	KH_YLL032C_2nd	132	163	0.018	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O05000`	Arabidopsis thaliana	sp\|O05000\|NU2M_ARATH NADH-ubiquinone oxidoreductase chain 2	56.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card