TkA02G578950 | RubberDandelionOmics

Gene overview

TkA02G578950

Reference: TK1151 Chr: Chr02 Coordinates: 149352253-149353521 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA02G578950|TK1151|cDNA

ATGATCTTTTTCGATTTCATATTCAAGAAGAAGGACGCACCACCTCCTGGACACTTTTTACGATTGGGGAAACCAAGGGCTCAAGACGATCTAATTTTGAGGAAGAGAGATATGATGCAGAGGTGGCTGTGTTGTACTTGCCAAGTTGAAGAGTCCTACCCTTCAAACGAAAATGGATTTACAAAAAACCACAATGATCACACTGATGGAATTCCAGCACAGCTTGCCAACTTAACTAATCTGAAAATATTGTATTTATC...

CDS

Download CDS FASTA

465 bp · TkA02G578950|TK1151|CDS

ATGATCTTTTTCGATTTCATATTCAAGAAGAAGGACGCACCACCTCCTGGACACTTTTTACGATTGGGGAAACCAAGGGCTCAAGACGATCTAATTTTGAGGAAGAGAGATATGATGCAGAGGTGGCTGTGTTGTACTTGCCAAGTTGAAGAGTCCTACCCTTCAAACGAAAATGGATTTACAAAAAACCACAATGATCACACTGATGGAATTCCAGCACAGCTTGCCAACTTAACTAATCTGAAAATATTGTATTTATC...

Protein

Download Protein FASTA

154 aa · TkA02G578950|TK1151|PROTEIN

MIFFDFIFKKKDAPPPGHFLRLGKPRAQDDLILRKRDMMQRWLCCTCQVEESYPSNENGFTKNHNDHTDGIPAQLANLTNLKILYLSYNKMSGIVPAGLAHNPKLTYLYLDHNQLSGKIPEAFYKHPYLKELCIEGNAFRPGVNPIGIHKVREL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G578950`
TK1151 ID	TkA02G578950
OH-1004 ID	LXL04_004198
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.300
Protein coverage (%)	TK1151 44.156 / OH-1004 15.297 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G578950

Location Chr02:149352253-149353521 (+)

Description Similar to PTI13: PTI1-like tyrosine-protein kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43230`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	CARK6 is involved in abscisic acid to regulate stress responses in Arabidopsis thaliana.2019 · DOI: 10.1016/j.bbrc.2019.03.180 Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004198 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:2000037 regulation of stomatal complex patterning Biological Process

GO:2000038 regulation of stomatal complex development Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G06700

ath:AT2G30740

ath:AT3G59350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.836

Rank 1 · TkA02G578950 · TK1151

Cytoplasm0.082

Rank 2 · TkA02G578950 · TK1151

Nucleus0.035

Rank 3 · TkA02G578950 · TK1151

Mitochondrion0.030

Rank 4 · TkA02G578950 · TK1151

Cell membrane0.027

Rank 5 · TkA02G578950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24048LRR_NXF1-561-120 aa

PF00560LRR_164-78 aa

PF23211LRR_LRWD167-139 aa

PF12799LRR_471-90 aa

PF13855LRR_874-115 aa

PF13516LRR_678-92 aa

PF12799LRR_479-115 aa

PF00560LRR_180-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G578950	`PF24048`	LRR_NXF1-5	61	120	0.15	12.4
TkA02G578950	`PF00560`	LRR_1	64	78	1.2e-10	40.1
TkA02G578950	`PF23211`	LRR_LRWD1	67	139	0.015	15.8
TkA02G578950	`PF12799`	LRR_4	71	90	2.4e-14	53.7
TkA02G578950	`PF13855`	LRR_8	74	115	5.2e-12	46.1
TkA02G578950	`PF13516`	LRR_6	78	92	4.9e-05	23.8
TkA02G578950	`PF12799`	LRR_4	79	115	2.4e-14	53.7
TkA02G578950	`PF00560`	LRR_1	80	101	1.2e-10	40.1
TkA02G578950	`PF13516`	LRR_6	101	118	4.9e-05	23.8
TkA02G578950	`PF12799`	LRR_4	103	137	2.4e-14	53.7
TkA02G578950	`PF00560`	LRR_1	104	124	1.2e-10	40.1
TkA02G578950	`PF13855`	LRR_8	112	138	5.2e-12	46.1
TkA02G578950	`PF13516`	LRR_6	126	138	4.9e-05	23.8
TkA02G578950	`PF00560`	LRR_1	129	141	1.2e-10	40.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW72`	Arabidopsis thaliana	sp\|Q9ZW72\|CARK6_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 6	60.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card