TkA02G572510 | RubberDandelionOmics

Gene overview

TkA02G572510

Reference: TK1151 Chr: Chr02 Coordinates: 147833982-147842699 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · TkA02G572510|TK1151|cDNA

AGAAAGAAAAACGAGGTGGACTACTTTGACTCTCTTCCCGACGACCTTCTTGTAGAGATCTTTAAAACTGTTGAACCGAATCTACTCCGTTTCAAGGCTAGATTCGTAACGGAAAAGTGGTTCAATTTAATCACGAACATTATCTTGTTAGACCACGCCTCATTAATCATACATAAATACGGACCAAGCCGCAGATTCCGTCTCTTGGATATAACAGAAGAAAGACACGGCCTAAAAACCAAAGAACAAGACATTATCAT...

CDS

Download CDS FASTA

1107 bp · TkA02G572510|TK1151|CDS

AGAAAGAAAAACGAGGTGGACTACTTTGACTCTCTTCCCGACGACCTTCTTGTAGAGATCTTTAAAACTGTTGAACCGAATCTACTCCGTTTCAAGGCTAGATTCGTAACGGAAAAGTGGTTCAATTTAATCACGAACATTATCTTGTTAGACCACGCCTCATTAATCATACATAAATACGGACCAAGCCGCAGATTCCGTCTCTTGGATATAACAGAAGAAAGACACGGCCTAAAAACCAAAGAACAAGACATTATCAT...

Protein

Download Protein FASTA

368 aa · TkA02G572510|TK1151|PROTEIN

RKKNEVDYFDSLPDDLLVEIFKTVEPNLLRFKARFVTEKWFNLITNIILLDHASLIIHKYGPSRRFRLLDITEERHGLKTKEQDIIIPYKGRIKCWCNEYLLIAIKKKDKSLYMYNLITKRGSHLPPCSKSCKHYSSECGVRLCYDESERVYKVIHVFTGPPLQCEILVIKSTRNMSEWKKVNRPDCMGQVQYNWNDPISVKGRYLYWDVQCPKYLVSMDMVKETFCQIRLPGSDINRNQTYCMVEIGGFLALIHKFLYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G572510`
TK1151 ID	TkA02G572510
OH-1004 ID	LXL04_012295
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.700
Protein coverage (%)	TK1151 95.380 / OH-1004 96.944 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G572510`
Location	Chr02:147833982-147842699 (-)
Description	Similar to At3g07870: F-box protein At3g07870
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012295` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008284 positive regulation of cell population proliferation Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009506 plasmodesma Cellular Component
KEGG gene cross-reference	ath:AT3G07870 ath:AT4G19940 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · TkA02G572510 · TK1151

Nucleus0.438

Rank 2 · TkA02G572510 · TK1151

Cell membrane0.146

Rank 3 · TkA02G572510 · TK1151

Endoplasmic reticulum0.085

Rank 4 · TkA02G572510 · TK1151

Lysosome / Vacuole0.049

Rank 5 · TkA02G572510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box9-49 aa

PF12937F-box-like9-44 aa

PF03478Beta-prop_KIB1-497-281 aa

PF08268FBA_3102-341 aa

PF00646F-box127-134 aa

PF00646F-box323-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G572510	`PF00646`	F-box	9	49	0.0025	18.4
TkA02G572510	`PF12937`	F-box-like	9	44	0.15	12.6
TkA02G572510	`PF03478`	Beta-prop_KIB1-4	97	281	2.4e-07	31.2
TkA02G572510	`PF08268`	FBA_3	102	341	4.9e-17	62.6
TkA02G572510	`PF00646`	F-box	127	134	0.0025	18.4
TkA02G572510	`PF00646`	F-box	323	332	0.0025	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card