TkA02G571770 | RubberDandelionOmics

Gene overview

TkA02G571770

Reference: TK1151 Chr: Chr02 Coordinates: 147648427-147650365 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1655 bp · TkA02G571770|TK1151|cDNA

CTGAAATCAATTATATGTAACCCTAAATCCATTCCCCATTTGCCAAAATGGATTCTCAATCCAATTCTCCGCACGTACTCATCTTTCCATTTCCAGTCCAGGGCCATGTCAGTTGTATGCTCAAACTTGCAGAGCTTCTCTGTCTCTCCGGCCTCTCTGTCACCTTCCTAAACTCCGACATCATCCACCGCCGTCTCCTCCGCTACACCGACGTCGTTTCTCGTTTTTCTCGATACCCAGGTTTCAGATTTGAGACCATT...

CDS

Download CDS FASTA

1458 bp · TkA02G571770|TK1151|CDS

ATGGATTCTCAATCCAATTCTCCGCACGTACTCATCTTTCCATTTCCAGTCCAGGGCCATGTCAGTTGTATGCTCAAACTTGCAGAGCTTCTCTGTCTCTCCGGCCTCTCTGTCACCTTCCTAAACTCCGACATCATCCACCGCCGTCTCCTCCGCTACACCGACGTCGTTTCTCGTTTTTCTCGATACCCAGGTTTCAGATTTGAGACCATTTCCGATGGGCTTCCGCCTGATCACCCTCGTTCCGGTAACAGGGTTGT...

Protein

Download Protein FASTA

485 aa · TkA02G571770|TK1151|PROTEIN

MDSQSNSPHVLIFPFPVQGHVSCMLKLAELLCLSGLSVTFLNSDIIHRRLLRYTDVVSRFSRYPGFRFETISDGLPPDHPRSGNRVVDIFDSIKMVTKPMFREMLLPGGCLNSGKRPPVSSIIADGIMCFTIDVAKDLGIPIFLFRTVSASCFWAFYCIPKLIESGDLPIKEDDEMDRLLIGVTGMEEYLRLRDLPSFCRASDLSDRAFQVVTTETQETYRANGLILNTFEDLEESALAQIRNHIPNLYSIGPLHANLKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G571770`
TK1151 ID	TkA02G571770
OH-1004 ID	LXL04_012333
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.588 / OH-1004 51.220 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G571770

Location Chr02:147648427-147650365 (-)

Description Similar to UGT709C2: 7-deoxyloganetic acid glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22370`	UDP-glycosyltransferase 85A5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012333 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1900994 (-)-secologanin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

GO:0102970 7-deoxyloganetic acid glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAO01109

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.739

Rank 1 · TkA02G571770 · TK1151

Nucleus0.236

Rank 2 · TkA02G571770 · TK1151

Endoplasmic reticulum0.072

Rank 3 · TkA02G571770 · TK1151

Plastid0.072

Rank 4 · TkA02G571770 · TK1151

Cell membrane0.065

Rank 5 · TkA02G571770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N10-44 aa

PF26168Glyco_transf_N211-255 aa

PF00201UDPGT286-413 aa

PF09524Phg_2220_C397-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G571770	`PF26168`	Glyco_transf_N	10	44	1.7e-05	25.5
TkA02G571770	`PF26168`	Glyco_transf_N	211	255	1.7e-05	25.5
TkA02G571770	`PF00201`	UDPGT	286	413	2.3e-23	83.5
TkA02G571770	`PF09524`	Phg_2220_C	397	445	0.18	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMF0`	Arabidopsis thaliana	sp\|Q9LMF0\|U85A5_ARATH UDP-glycosyltransferase 85A5	41.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card