TkA02G571760 | RubberDandelionOmics

Gene overview

TkA02G571760

Reference: TK1151 Chr: Chr02 Coordinates: 147643922-147645463 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · TkA02G571760|TK1151|cDNA

ATGTCTCCTCATGTCCTGATTTTCCCATTGTCAATGCAAGGCCCTGTAAATTGTATGCTTAAATTAGCAGAGCTACTCTGTCTCTCCGGCATCTCCGTCACTGTCCTCAACACCGACCACATCCAACGCTCTCTCATCCGACATACCGATGTCTTATCCCGATTCAGCCGCTACAGTAATTTTCGTTTTGAAACTATCTCCGACGGGCTCCCTGACGATCATCCTCGTTCCGGCGACCGGTTTCTGGATATATTGGAAGG...

CDS

Download CDS FASTA

1425 bp · TkA02G571760|TK1151|CDS

ATGTCTCCTCATGTCCTGATTTTCCCATTGTCAATGCAAGGCCCTGTAAATTGTATGCTTAAATTAGCAGAGCTACTCTGTCTCTCCGGCATCTCCGTCACTGTCCTCAACACCGACCACATCCAACGCTCTCTCATCCGACATACCGATGTCTTATCCCGATTCAGCCGCTACAGTAATTTTCGTTTTGAAACTATCTCCGACGGGCTCCCTGACGATCATCCTCGTTCCGGCGACCGGTTTCTGGATATATTGGAAGG...

Protein

Download Protein FASTA

474 aa · TkA02G571760|TK1151|PROTEIN

MSPHVLIFPLSMQGPVNCMLKLAELLCLSGISVTVLNTDHIQRSLIRHTDVLSRFSRYSNFRFETISDGLPDDHPRSGDRFLDILEGFRTVTEPAFREMMVSGCFSSKSAFPVTLIIPDGSFSFALDVAEEIEIPLIYFETVSPCALWTYLCLPKLIQAGEVPFDGDDLDVPIKSVPGTETFLRRRDLPSFYRSDDLSNPALHIIMNEAQHVPRAHGLIINTFEALDASILVHMRSLCPNIYTIGPLHTLLKSRLTIAHQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G571760`
TK1151 ID	TkA02G571760
OH-1004 ID	LXL04_012333
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 97.468 / OH-1004 48.993 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G571760`
Location	Chr02:147643922-147645463 (-)
Description	Similar to UGT709C2: 7-deoxyloganetic acid glucosyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012333` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:1900994 (-)-secologanin biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function GO:0102970 7-deoxyloganetic acid glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:BAO01109 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.781

Rank 1 · TkA02G571760 · TK1151

Nucleus0.236

Rank 2 · TkA02G571760 · TK1151

Endoplasmic reticulum0.074

Rank 3 · TkA02G571760 · TK1151

Plastid0.065

Rank 4 · TkA02G571760 · TK1151

Cell membrane0.045

Rank 5 · TkA02G571760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT117-147 aa

PF06722EryCIII-like_C225-259 aa

PF031712OG-FeII_Oxy252-310 aa

PF00201UDPGT277-428 aa

PF06722EryCIII-like_C349-428 aa

PF04101Glyco_tran_28_C367-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G571760	`PF00201`	UDPGT	117	147	1e-21	78.1
TkA02G571760	`PF06722`	EryCIII-like_C	225	259	3e-06	28.0
TkA02G571760	`PF03171`	2OG-FeII_Oxy	252	310	0.0097	16.9
TkA02G571760	`PF00201`	UDPGT	277	428	1e-21	78.1
TkA02G571760	`PF06722`	EryCIII-like_C	349	428	3e-06	28.0
TkA02G571760	`PF04101`	Glyco_tran_28_C	367	438	0.38	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card