RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G567550
Reference: TK1151 Chr: Chr02 Coordinates: 146619577-146623623 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1620 bp · TkA02G567550|TK1151|cDNA

AGAAGGTTCTTGTTAATAAAAGCAGCGAGTAAAACCCCCTAACGACCAATCGTTTGGGGCTCCCAACAATCCTTCTCTGTATCCATTTCTGTCGTATACAAGAGAAAACGAGGGAAATTAGGGTTGAATTTGTTTCCAATCCGTACGAAACAGAGTAATCGTCAGAATCCAAATTGTTGATCTCTTGTCTCTAAGCCAAATATGAAGGCTTTGATTCTTGTTGGAGGATTCGGGACCCGTTTGAGGCCATTGACTCTCAG...

CDS

Download CDS FASTA

1086 bp · TkA02G567550|TK1151|CDS

ATGAAGGCTTTGATTCTTGTTGGAGGATTCGGGACCCGTTTGAGGCCATTGACTCTCAGTGTCCCAAAACCACTCGTTGATTTTGGCAACAAACCGATGATCTTACACCAAATTGAAGCTCTCAAAGCCATAGGAGTTACCGAAGTTGTTCTTGCTATCAACTATCAACCAGAGGTGATGCTCAACTTCTTGAAAGACTTTGAAGCAAAACTCGGGATAACAATCACATGCTCACAAGAAACCGAGCCACTCGGGACCGC...

Protein

Download Protein FASTA

361 aa · TkA02G567550|TK1151|PROTEIN

MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKAIGVTEVVLAINYQPEVMLNFLKDFEAKLGITITCSQETEPLGTAGPLALARDKLLDNSGDPFFVLNSDVISEYPLKQMIAFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQVEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKETFPKIASEKLLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKNTPGSLATGPHIVGNVLVHES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G567550
TK1151 IDTkA02G567550
OH-1004 IDLXL04_009597
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)30.200
Protein coverage (%)TK1151 99.446 / OH-1004 97.362
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G567550
LocationChr02:146619577-146623623 (-)
DescriptionSimilar to gmppA: Mannose-1-phosphate guanyltransferase alpha
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g39770 Essential protein during embryogenesis.
Genetic evidence for the role of GDP-mannose in plant ascorbic acid (vitamin C) biosynthesis.1999 · DOI: 10.1073/pnas.96.7.4198
Identification of ascorbic acid-deficient Arabidopsis thaliana mutants.2000 · DOI: 10.1093/genetics/154.2.847
Arabidopsis cyt1 mutants are deficient in a mannose-1-phosphate guanylyltransferase and point to a requirement of N-linked glycosylation for cellulose biosynthesis.2001 · DOI: 10.1073/pnas.051625798
Leaf vitamin C contents modulate plant defense transcripts and regulate genes that control development through hormone signaling.2003 · DOI: 10.1105/tpc.010538
The timing of senescence and response to pathogens is altered in the ascorbate-deficient Arabidopsis mutant vitamin c-1.2004 · DOI: 10.1104/pp.103.032185
Ascorbic acid deficiency activates cell death and disease resistance responses in Arabidopsis.2005 · DOI: 10.1104/pp.105.067686
Modulation of plant morphology, root architecture, and cell structure by low vitamin C in Arabidopsis thaliana.2006 · DOI: 10.1093/jxb/erl010
Antioxidant status, peroxidase activity, and PR protein transcript levels in ascorbate-deficient Arabidopsis thaliana vtc mutants.2008 · DOI: 10.1093/jxb/ern229
Environmental stress sensitivity of an ascorbic acid-deficient Arabidopsis mutant.1996 · DOI: 10.1073/pnas.93.18.9970
L-ascorbic acid metabolism in the ascorbate-deficient arabidopsis mutant vtc1.1997 · DOI: 10.1104/pp.115.3.1277
At3g55590 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0237200 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. No verified direct reference in this release
Os03g0268400 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. No verified direct reference in this release
Os01g0847200 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009597 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009298 GDP-mannose biosynthetic process Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0004475 mannose-1-phosphate guanylyltransferase (GTP) activity Molecular Function
GO:0005525 GTP binding Molecular Function
GO:0016740 transferase activity Molecular Function
GO:0016779 nucleotidyltransferase activity Molecular Function
KEGG gene cross-reference
ddi:DDB_G0271858
dre:393469
xla:444472
xtr:779654
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.713
Rank 1 · TkA02G567550 · TK1151
Nucleus0.297
Rank 2 · TkA02G567550 · TK1151
Mitochondrion0.086
Rank 3 · TkA02G567550 · TK1151
Cell membrane0.061
Rank 4 · TkA02G567550 · TK1151
Peroxisome0.058
Rank 5 · TkA02G567550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00483NTP_transferase2-233 aa
PF01128IspD2-57 aa
PF12804NTP_transf_33-138 aa
PF02348CTP_transf_323-52 aa
PF07959Fucose_pyrophosphorylase105-165 aa
PF25087GMPPB_C170-193 aa
PF14602Hexapep_2172-178 aa
PF14602Hexapep_2191-199 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G567550PF00483NTP_transferase22331.5e-61208.8
TkA02G567550PF01128IspD2570.1712.3
TkA02G567550PF12804NTP_transf_331385.2e-1040.4
TkA02G567550PF02348CTP_transf_323520.02715.0
TkA02G567550PF07959Fucose_pyrophosphorylase1051650.001818.0
TkA02G567550PF25087GMPPB_C1701936.4e-44148.9
TkA02G567550PF14602Hexapep_21721780.3211.5
TkA02G567550PF14602Hexapep_21911990.3211.5
TkA02G567550PF25084LbH_EIF2B2443363.6e-1246.9
TkA02G567550PF25087GMPPB_C2513606.4e-44148.9
TkA02G567550PF00132Hexapep2552871.9e-0937.5
TkA02G567550PF07959Fucose_pyrophosphorylase2553090.001818.0
TkA02G567550PF25247LbH_GLGC2572690.0008919.9
TkA02G567550PF14602Hexapep_22622870.3211.5
TkA02G567550PF24894Hexapep_GlmU2733366e-0523.8
TkA02G567550PF25247LbH_GLGC2843320.0008919.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22287Arabidopsis thalianasp|O22287|GMPP1_ARATH Mannose-1-phosphate guanylyltransferase 189.200%Swiss-ProtHigh
Q9M2S0Arabidopsis thalianasp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 282.400%Swiss-ProtHigh
Q6Z9A3Oryza sativa subsp. japonicasp|Q6Z9A3|GMPP3_ORYSJ Probable mannose-1-phosphate guanylyltransferase 387.800%Swiss-ProtHigh
Q84JH5Oryza sativa subsp. japonicasp|Q84JH5|GMPP1_ORYSJ Probable mannose-1-phosphate guanylyltransferase 187.500%Swiss-ProtHigh
Q941T9Oryza sativa subsp. japonicasp|Q941T9|GMPP2_ORYSJ Probable mannose-1-phosphate guanylyltransferase 288.100%Swiss-ProtHigh

JBrowse

View in Genome Browser