TkA02G566840 | RubberDandelionOmics

Gene overview

TkA02G566840

Reference: TK1151 Chr: Chr02 Coordinates: 146449961-146454891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4287 bp · TkA02G566840|TK1151|cDNA

ATGCCTGCTTCTTCGGTCACTCCTGCTCCTGCGACGGTGAACGACCGAACTCCTCCCTCTCGGTCACTCCTGCCTTGGACGAATCAGCTTCGGATTTTAGTCTTCATATCTTATATTATTCTTAATGAAACTGGGCTCGAGAGAAAAAGCTCTAGAGGTGACAGGAAAGCGACACCTGGGAAACTATTTTCTGTACCCGCGACCTGGCCAGCATTAAATGCTGACAGGAGCTCCGACGTCCAAAAATCAACGAGAAGTAG...

CDS

Download CDS FASTA

4287 bp · TkA02G566840|TK1151|CDS

ATGCCTGCTTCTTCGGTCACTCCTGCTCCTGCGACGGTGAACGACCGAACTCCTCCCTCTCGGTCACTCCTGCCTTGGACGAATCAGCTTCGGATTTTAGTCTTCATATCTTATATTATTCTTAATGAAACTGGGCTCGAGAGAAAAAGCTCTAGAGGTGACAGGAAAGCGACACCTGGGAAACTATTTTCTGTACCCGCGACCTGGCCAGCATTAAATGCTGACAGGAGCTCCGACGTCCAAAAATCAACGAGAAGTAG...

Protein

Download Protein FASTA

1428 aa · TkA02G566840|TK1151|PROTEIN

MPASSVTPAPATVNDRTPPSRSLLPWTNQLRILVFISYIILNETGLERKSSRGDRKATPGKLFSVPATWPALNADRSSDVQKSTRSRRSQVFRDPSKVQRRTCPGKEPQNLGTAKWRHPWDVVQMVTTNQAVIGNSPIAGMPTFDDGTTTPVRNPPGGSQITTPNIHAVTQNTVTTEDHAEKEMEEFIKYQKYQAIKKRHLEKEQIREGKMFPGKRGKERKETRTKRRAYSSTSEDSSGEIPRRKKGGGKKQTEKAFKCY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G566840`
TK1151 ID	TkA02G566840
OH-1004 ID	LXL04_016385
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.700
Protein coverage (%)	TK1151 92.017 / OH-1004 37.111 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G566840`
Location	Chr02:146449961-146454891 (+)
Description	Similar to KIN14N: Kinesin-like protein KIN-14N
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016385` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000226 microtubule cytoskeleton organization Biological Process GO:0007018 microtubule-based movement Biological Process GO:0009971 anastral spindle assembly involved in male meiosis Biological Process GO:0051225 spindle assembly Biological Process GO:0051301 cell division Biological Process GO:0000776 kinetochore Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005819 spindle Cellular Component GO:0005871 kinesin complex Cellular Component GO:0005872 minus-end kinesin complex Cellular Component
KEGG gene cross-reference	ath:AT4G05190 ath:AT4G21270 ath:AT4G27180 ath:AT5G54670 dosa:Os07g0105700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · TkA02G566840 · TK1151

Nucleus0.312

Rank 2 · TkA02G566840 · TK1151

Cell membrane0.121

Rank 3 · TkA02G566840 · TK1151

Mitochondrion0.065

Rank 4 · TkA02G566840 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA02G566840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22251PFF1_TM20-42 aa

PF03242LEA_3a225-277 aa

PF22251PFF1_TM248-359 aa

PF03732PEG10_N-capsid336-403 aa

PF00075RNase_H903-930 aa

PF00078RVT_1946-1106 aa

PF17919RT_RNaseH_21172-1270 aa

PF17917RT_RNaseH1198-1298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G566840	`PF22251`	PFF1_TM	20	42	0.28	11.4
TkA02G566840	`PF03242`	LEA_3a	225	277	0.12	13.6
TkA02G566840	`PF22251`	PFF1_TM	248	359	0.28	11.4
TkA02G566840	`PF03732`	PEG10_N-capsid	336	403	0.00038	21.5
TkA02G566840	`PF00075`	RNase_H	903	930	3.1e-06	28.1
TkA02G566840	`PF00078`	RVT_1	946	1106	8e-33	114.7
TkA02G566840	`PF17919`	RT_RNaseH_2	1172	1270	7e-19	68.5
TkA02G566840	`PF17917`	RT_RNaseH	1198	1298	1.9e-17	64.0
TkA02G566840	`PF00075`	RNase_H	1346	1421	3.1e-06	28.1
TkA02G566840	`PF13456`	RVT_3	1355	1424	1.2e-10	42.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card