TkA02G566480 | RubberDandelionOmics

Gene overview

TkA02G566480

Reference: TK1151 Chr: Chr02 Coordinates: 146336213-146339316 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2443 bp · TkA02G566480|TK1151|cDNA

AAAGTAATCTGTCCTTTTATTCAAACCACCAAAAGTAACAGTCTCAAGGTTGAATTTTTCAACCTACTCCTCTTCCCTACGGCTATTTGCTTTCCCCTTCACGGTATCATTTATTTTGAATCAAGCGCAGAGCGCCCTTGCGATCACGCTTTTACCTGCTTTCTTGTTTCTTTAAATCAAATTTCAGCAAATTGAAATAAGCCACACATCCCTTTTCCCGATTCCTGTCTTTTTCAATTAAACATTTAACCTTTTCCTTT...

CDS

Download CDS FASTA

1713 bp · TkA02G566480|TK1151|CDS

ATGGAAAATTCAGTTGATAGCAGTGTAAAAAAGGACGAATTTGATTCGTTCGATAGCATAACAACAAGCTTGAGTTCGAGTAATTCAGTCGCTTCTTCTAAAGAATCTTGTTCTTCCGATTCTCCTCTTGGTTGGCCTATTCGAAAGGCTCAAGTGACTAGCGAATGTGATGTTTCTCAAGAAAAATCCAAAACAAAAACCCATTTCGACAGTGAATCCAAAATCAAGAAAATGGGTGCAACAGTTTCAGCAGAAATGGA...

Protein

Download Protein FASTA

570 aa · TkA02G566480|TK1151|PROTEIN

MENSVDSSVKKDEFDSFDSITTSLSSSNSVASSKESCSSDSPLGWPIRKAQVTSECDVSQEKSKTKTHFDSESKIKKMGATVSAEMELMKERFGKLLLGEDMSGSGKGVCTALAISNSITNLFATAFGQLWRLEPLPYEKKRMWQREMECLLCVSDHIVEFKPSWQTLADGSKLEIMTCRPRSDIFVNLPALRKLDNMLLAILDSFTSTEFWYVDKGITTPEPTFHKPLQRQEDKWWLPVPRVPANGLHEATRKQLNHKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G566480`
TK1151 ID	TkA02G566480
OH-1004 ID	LXL04_012413
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G566480

Location Chr02:146336213-146339316 (+)

Description Similar to ROPGEF5: Rop guanine nucleotide exchange factor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05940`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release
`At5g02010`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	RopGEF7 regulates PLETHORA-dependent maintenance of the root stem cell niche in Arabidopsis.2011 · DOI: 10.1105/tpc.111.085514
`At3g55660`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release
`At4g38430`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	Members of a novel class of Arabidopsis Rho guanine nucleotide exchange factors control Rho GTPase-dependent polar growth.2006 · DOI: 10.1105/tpc.105.036434 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis.2012 · DOI: 10.1016/j.febslet.2012.03.040 AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
`At4g00460`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012413 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G55660

ath:AT4G00460

ath:AT4G38430

ath:AT5G02010

ath:AT5G05940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.507

Rank 1 · TkA02G566480 · TK1151

Cytoplasm0.396

Rank 2 · TkA02G566480 · TK1151

Cell membrane0.077

Rank 3 · TkA02G566480 · TK1151

Mitochondrion0.072

Rank 4 · TkA02G566480 · TK1151

Golgi apparatus0.044

Rank 5 · TkA02G566480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25812RAD24_helical10-78 aa

PF29014Put_cell_wall11-36 aa

PF03759PRONE85-438 aa

PF25812RAD24_helical304-332 aa

PF25812RAD24_helical397-463 aa

PF29014Put_cell_wall478-547 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G566480	`PF25812`	RAD24_helical	10	78	0.13	13.1
TkA02G566480	`PF29014`	Put_cell_wall	11	36	0.79	10.4
TkA02G566480	`PF03759`	PRONE	85	438	5.9e-175	582.1
TkA02G566480	`PF25812`	RAD24_helical	304	332	0.13	13.1
TkA02G566480	`PF25812`	RAD24_helical	397	463	0.13	13.1
TkA02G566480	`PF29014`	Put_cell_wall	478	547	0.79	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K295`	Arabidopsis thaliana	sp\|F4K295\|ROGF5_ARATH Rop guanine nucleotide exchange factor 5	59.300%	Swiss-Prot	High
`Q9LZN0`	Arabidopsis thaliana	sp\|Q9LZN0\|ROGF7_ARATH Rop guanine nucleotide exchange factor 7	71.100%	Swiss-Prot	Medium
`Q9M056`	Arabidopsis thaliana	sp\|Q9M056\|ROFG6_ARATH Rop guanine nucleotide exchange factor 6	52.300%	Swiss-Prot	High
`Q93ZY2`	Arabidopsis thaliana	sp\|Q93ZY2\|ROGF1_ARATH Rop guanine nucleotide exchange factor 1	62.200%	Swiss-Prot	Medium
`A4IJ27`	Arabidopsis thaliana	sp\|A4IJ27\|ROGF3_ARATH Rop guanine nucleotide exchange factor 3	53.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card