Gene Card
Gene overview
cDNA / CDS / Protein Sequences
390 bp · TkA02G563650|TK1151|cDNA
AGAAAATCCGATTTCGCAGAGGATTCTCTGCGGTTTCGCAGAGCATCTAAGGTAAACGTGCGTTCGTCGCTTGGCTCCCCATTTCGCGAAACAGAAAGCCTTCTGCGAAAAAAAGGACCTCCTCCCCTTCTGCGAAAAACGACGGTGGTGGCCTCCCGATATCGCGAACTAGCTTCTGCACTCGATCGATCGGCGAATATGGAAGAAATCATTGCTGATGGATTCGGCAATATGATCCAGAGCTTTCTTTTTCAGTTCTG...
390 bp · TkA02G563650|TK1151|CDS
AGAAAATCCGATTTCGCAGAGGATTCTCTGCGGTTTCGCAGAGCATCTAAGGTAAACGTGCGTTCGTCGCTTGGCTCCCCATTTCGCGAAACAGAAAGCCTTCTGCGAAAAAAAGGACCTCCTCCCCTTCTGCGAAAAACGACGGTGGTGGCCTCCCGATATCGCGAACTAGCTTCTGCACTCGATCGATCGGCGAATATGGAAGAAATCATTGCTGATGGATTCGGCAATATGATCCAGAGCTTTCTTTTTCAGTTCTG...
Protein
Download Protein FASTA129 aa · TkA02G563650|TK1151|PROTEIN
RKSDFAEDSLRFRRASKVNVRSSLGSPFRETESLLRKKGPPPLLRKTTVVASRYRELASALDRSANMEEIIADGFGNMIQSFLFQFCKGVAHCHGHGVLHRLYSGFYNWHAYPRWGHRIWQVLIVNMIC
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G563650 |
|---|---|
| TK1151 ID | TkA02G563650 |
| OH-1004 ID | LXL04_012212 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 80.000 |
| Protein coverage (%) | TK1151 34.884 / OH-1004 3.843Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G563650 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:145575387-145576198 (+) | ||||||||||||
| Description | Similar to PUB1: U-box domain-containing protein 1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009877 nodulation Biological Process GO:0016567 protein ubiquitination Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050777 negative regulation of immune response Biological Process GO:0098542 defense response to other organism Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT1G29340 ath:AT3G46510 ath:AT3G54850 dosa:Os06g0102700 mtr:11430446 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069Pkinase78-101 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G563650 | PF00069 | Pkinase | 78 | 101 | 0.12 | 12.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.