TkA02G560680 | RubberDandelionOmics

Gene overview

TkA02G560680

Reference: TK1151 Chr: Chr02 Coordinates: 144808897-144810274 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

854 bp · TkA02G560680|TK1151|cDNA

CGCCATTCTTTTCCGGTTATTATAAGTTTCATCTCTATCGTACATCAAAACCCTAATAGCTGCCGCGCGAACTCTCCCCGTATCCGTTTCGCAGTTGATCGGCTGTTGAAGCAGCTTCTATTACCAATGGCGCCTAAAGCTGACACAACGAAGAAAGGTGATGCAAAGTCCCAAGCTTTGAAGACAGCAAAGGCTGTAAAAACTGGTTCAACATTCAAAAAGAAGGCCAAGAAGATCAGAACCAAGGTCACCTTCCACCG...

CDS

Download CDS FASTA

588 bp · TkA02G560680|TK1151|CDS

CGCCATTCTTTTCCGGTTATTATAAGTTTCATCTCTATCGTACATCAAAACCCTAATAGCTGCCGCGCGAACTCTCCCCGTATCCGTTTCGCAGTTGATCGGCTGTTGAAGCAGCTTCTATTACCAATGGCGCCTAAAGCTGACACAACGAAGAAAGGTGATGCAAAGTCCCAAGCTTTGAAGACAGCAAAGGCTGTAAAAACTGGTTCAACATTCAAAAAGAAGGCCAAGAAGATCAGAACCAAGGTCACCTTCCACCG...

Protein

Download Protein FASTA

195 aa · TkA02G560680|TK1151|PROTEIN

RHSFPVIISFISIVHQNPNSCRANSPRIRFAVDRLLKQLLLPMAPKADTTKKGDAKSQALKTAKAVKTGSTFKKKAKKIRTKVTFHRPRTLKTDRNPKYPRISAPPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G560680`
TK1151 ID	TkA02G560680
OH-1004 ID	LXL04_021966
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 78.462 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G560680

Location Chr02:144808897-144810274 (+)

Description Similar to RPL23A: 60S ribosomal protein L23a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55280`	Binds to a specific region on the 26S rRNA.	No verified direct reference in this release
`At2g39460`	Binds to a specific region on the 26S rRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021966 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

KEGG gene cross-reference

ath:AT2G39460

ath:AT3G55280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.298

Rank 1 · TkA02G560680 · TK1151

Cytoplasm0.273

Rank 2 · TkA02G560680 · TK1151

Plastid0.259

Rank 3 · TkA02G560680 · TK1151

Nucleus0.089

Rank 4 · TkA02G560680 · TK1151

Peroxisome0.040

Rank 5 · TkA02G560680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27077CsxA54-79 aa

PF03939Ribosomal_L23eN55-105 aa

PF00276Ribosomal_L2373-80 aa

PF00276Ribosomal_L23114-175 aa

PF27077CsxA114-188 aa

PF03939Ribosomal_L23eN147-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G560680	`PF27077`	CsxA	54	79	0.023	15.2
TkA02G560680	`PF03939`	Ribosomal_L23eN	55	105	3.4e-18	66.2
TkA02G560680	`PF00276`	Ribosomal_L23	73	80	1.6e-13	51.5
TkA02G560680	`PF00276`	Ribosomal_L23	114	175	1.6e-13	51.5
TkA02G560680	`PF27077`	CsxA	114	188	0.023	15.2
TkA02G560680	`PF03939`	Ribosomal_L23eN	147	165	3.4e-18	66.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3C3`	Arabidopsis thaliana	sp\|Q9M3C3\|R23A2_ARATH Large ribosomal subunit protein uL23y	81.800%	Swiss-Prot	High
`Q8LD46`	Arabidopsis thaliana	sp\|Q8LD46\|R23A1_ARATH Large ribosomal subunit protein uL23z	79.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card