TkA02G556610 | RubberDandelionOmics

Gene overview

TkA02G556610

Reference: TK1151 Chr: Chr02 Coordinates: 143689730-143692033 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · TkA02G556610|TK1151|cDNA

ATGGGTTTAGGTCTATCTATCCTCATAGGCATAAAATCCTTAACTTTATTCTGTTTCTTTATCTCACTTCGAATCCTCAAATTCACTCTGCTACCAATCCCATTTCTGTATGGATCTTTGATATCATTCTTGGTTTCAATTGCTTCCCATCCATCAATCAATCTCCCCTTACTTTTAGGGAAAGATTCAGATGGGAGCTTCCCCATTTGGTCACTGATGATGTTCGGGCCCTACTTGTATTTTGTTCGGGCCTTTTCATT...

CDS

Download CDS FASTA

762 bp · TkA02G556610|TK1151|CDS

ATGGGTTTAGGTCTATCTATCCTCATAGGCATAAAATCCTTAACTTTATTCTGTTTCTTTATCTCACTTCGAATCCTCAAATTCACTCTGCTACCAATCCCATTTCTGTATGGATCTTTGATATCATTCTTGGTTTCAATTGCTTCCCATCCATCAATCAATCTCCCCTTACTTTTAGGGAAAGATTCAGATGGGAGCTTCCCCATTTGGTCACTGATGATGTTCGGGCCCTACTTGTATTTTGTTCGGGCCTTTTCATT...

Protein

Download Protein FASTA

253 aa · TkA02G556610|TK1151|PROTEIN

MGLGLSILIGIKSLTLFCFFISLRILKFTLLPIPFLYGSLISFLVSIASHPSINLPLLLGKDSDGSFPIWSLMMFGPYLYFVRAFSFIRRFTSGEAPYNEICEGLYVGGWPYSPAKLPPGNPAIIDCTCELPRKKALSGNAYLCIPTWDTRAPEPSQIESAVNWACRKRAQKIPVFIHCAYGHGRSVAVMCALLVALGLAEDWKSAEKMIKQKRPCIRMNALHRKALEEWSKDRLSPPKRKGEFGATSIAASR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G556610`
TK1151 ID	TkA02G556610
OH-1004 ID	LXL04_022152
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.200
Protein coverage (%)	TK1151 94.466 / OH-1004 97.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G556610`
Location	Chr02:143689730-143692033 (-)
Description	Similar to ynbD: Uncharacterized protein YnbD (Escherichia coli (strain K12)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022152` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005886 plasma membrane Cellular Component GO:0004721 phosphoprotein phosphatase activity Molecular Function
KEGG gene cross-reference	ecj:JW1408 eco:b1411 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.356

Rank 1 · TkA02G556610 · TK1151

Mitochondrion0.196

Rank 2 · TkA02G556610 · TK1151

Plastid0.141

Rank 3 · TkA02G556610 · TK1151

Cytoplasm0.122

Rank 4 · TkA02G556610 · TK1151

Golgi apparatus0.104

Rank 5 · TkA02G556610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782DSPc123-232 aa

PF22785Tc-R-P138-198 aa

PF14566PTPlike_phytase141-192 aa

PF22784PTP-SAK143-209 aa

PF22741PTP-NADK145-194 aa

PF00102Y_phosphatase147-201 aa

PF04179Init_tRNA_PT157-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G556610	`PF00782`	DSPc	123	232	9.2e-11	42.4
TkA02G556610	`PF22785`	Tc-R-P	138	198	4.8e-07	31.0
TkA02G556610	`PF14566`	PTPlike_phytase	141	192	0.0024	18.7
TkA02G556610	`PF22784`	PTP-SAK	143	209	4.9e-06	27.4
TkA02G556610	`PF22741`	PTP-NADK	145	194	0.029	14.5
TkA02G556610	`PF00102`	Y_phosphatase	147	201	0.01	16.2
TkA02G556610	`PF04179`	Init_tRNA_PT	157	202	0.22	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card