TkA02G556600 | RubberDandelionOmics

Gene overview

TkA02G556600

Reference: TK1151 Chr: Chr02 Coordinates: 143687787-143689111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkA02G556600|TK1151|cDNA

ATGCGGAAGCAAGTTCTCTCGTTGACGGAAACCGCCGCTTCTAGAATACGTCAACTCCTGGACCAGCGCCAGCGTTCTTTCCTCAAGCTCGGCGTCAAGGCTCGCGGCTGCAACGGCTTATCCTACACCCTCAATTACGCCGATGATAAGGGAAAGTTTGACGAGTTGGTTGAGGACAAAGGAGTGAAGATCTTAATTGATCCAAAGGCCCTAATGCATGTAATAGGAACAAAGATGGATTTTGTAGATGACAAACTGAG...

CDS

Download CDS FASTA

375 bp · TkA02G556600|TK1151|CDS

ATGCGGAAGCAAGTTCTCTCGTTGACGGAAACCGCCGCTTCTAGAATACGTCAACTCCTGGACCAGCGCCAGCGTTCTTTCCTCAAGCTCGGCGTCAAGGCTCGCGGCTGCAACGGCTTATCCTACACCCTCAATTACGCCGATGATAAGGGAAAGTTTGACGAGTTGGTTGAGGACAAAGGAGTGAAGATCTTAATTGATCCAAAGGCCCTAATGCATGTAATAGGAACAAAGATGGATTTTGTAGATGACAAACTGAG...

Protein

Download Protein FASTA

124 aa · TkA02G556600|TK1151|PROTEIN

MRKQVLSLTETAASRIRQLLDQRQRSFLKLGVKARGCNGLSYTLNYADDKGKFDELVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFIFINPNSAGQCGCGESFMTISKSEAAKRAGGSGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G556600`
TK1151 ID	TkA02G556600
OH-1004 ID	LXL04_022153
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.700
Protein coverage (%)	TK1151 95.968 / OH-1004 85.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G556600

Location Chr02:143687787-143689111 (+)

Description Similar to At2g16710: Iron-sulfur assembly protein IscA-like 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16710`	Involved in the assembly of mitochondrial iron-sulfur proteins.	No verified direct reference in this release
`At2g36260`	Involved in the assembly of mitochondrial iron-sulfur proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022153 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009102 biotin biosynthetic process Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0044572 [4Fe-4S] cluster assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0071000 response to magnetism Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0120510 mitochondrial [4Fe-4S] assembly complex Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT2G16710

ath:AT2G36260

dme:Dmel_CG8198

rpr:RP484

sce:YLL027W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.795

Rank 1 · TkA02G556600 · TK1151

Cytoplasm0.231

Rank 2 · TkA02G556600 · TK1151

Nucleus0.107

Rank 3 · TkA02G556600 · TK1151

Cell membrane0.046

Rank 4 · TkA02G556600 · TK1151

Peroxisome0.028

Rank 5 · TkA02G556600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01521Fe-S_biosyn6-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G556600	`PF01521`	Fe-S_biosyn	6	105	1.2e-18	68.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBM4`	Arabidopsis thaliana	sp\|Q8LBM4\|ISAM1_ARATH Iron-sulfur assembly protein IscA-like 1, mitochondrial	79.800%	Swiss-Prot	High
`Q8L8C0`	Arabidopsis thaliana	sp\|Q8L8C0\|ISAM3_ARATH Iron-sulfur assembly protein IscA-like 3, mitochondrial	75.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card