TkA02G554850 | RubberDandelionOmics

Gene overview

TkA02G554850

Reference: TK1151 Chr: Chr02 Coordinates: 143167885-143169190 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · TkA02G554850|TK1151|cDNA

ATGGGTCATAAAACCCCAGAAAATGAGATGGACCTGATAAGGGATGACGAGTATGAGAGTAAATCAGGTACTGATATCATGGAGGCACCATCTGGAGATGATCAAGATCCTAATCAGCGCCCCAAGAAGAAGAGATACCATCGCCACACGCAGCATCAAATCCAGGAAATGGAATCGTTTTTCAATGAATGCCCTCACCCTGATGACAAACAAAGGAAGGAGCTTGGCCGTAGATTAGGCTTGGAGCCTTTGCAGGTTAA...

CDS

Download CDS FASTA

849 bp · TkA02G554850|TK1151|CDS

ATGGGTCATAAAACCCCAGAAAATGAGATGGACCTGATAAGGGATGACGAGTATGAGAGTAAATCAGGTACTGATATCATGGAGGCACCATCTGGAGATGATCAAGATCCTAATCAGCGCCCCAAGAAGAAGAGATACCATCGCCACACGCAGCATCAAATCCAGGAAATGGAATCGTTTTTCAATGAATGCCCTCACCCTGATGACAAACAAAGGAAGGAGCTTGGCCGTAGATTAGGCTTGGAGCCTTTGCAGGTTAA...

Protein

Download Protein FASTA

282 aa · TkA02G554850|TK1151|PROTEIN

MGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKRYHRHTQHQIQEMESFFNECPHPDDKQRKELGRRLGLEPLQVKFWFQNKRTQMKAQHERHENTQLRNENEKLRAENIRYKEALSNATCPNCGGPAAIGEMSFDEQHLRIENARLKRRGLIGYPDSCKYVGKPMLSYPHLPTGASSRSLDLGVGNFGPQTGMSGEVYGAADLLRSVSGPTDADKPVIIELAVAAMEELIRMAQAGEPLWIPSPDSSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G554850`
TK1151 ID	TkA02G554850
OH-1004 ID	LXL04_010080
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.200
Protein coverage (%)	TK1151 100.000 / OH-1004 38.981 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G554850

Location Chr02:143167885-143169190 (+)

Description Similar to PDF2: Homeobox-leucine zipper protein PROTODERMAL FACTOR 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04890`	Probable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'.	Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292 Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211 Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647
`At4g21750`	Probable transcription factor involved in cell specification and pattern formation during embryogenesis.	Identification of a cis-regulatory element for L1 layer-specific gene expression, which is targeted by an L1-specific homeodomain protein.2001 · DOI: 10.1046/j.1365-313x.2001.01047.x Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292 Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647
`At1g05230`	Probable transcription factor (By similarity).	Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0627000`	Probable transcription factor.	No verified direct reference in this release
`Os08g0187500`	Probable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis.	Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formation in early rice embryogenesis.2002 · DOI: 10.1046/j.1365-313x.2002.01234.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010080 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009845 seed germination Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048497 maintenance of floral organ identity Biological Process

GO:0048825 cotyledon development Biological Process

GO:0052541 plant-type cell wall cellulose metabolic process Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:2000033 regulation of seed dormancy process Biological Process

KEGG gene cross-reference

ath:AT1G05230

ath:AT4G04890

ath:AT4G21750

dosa:Os04g0627000

dosa:Os08g0187500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA02G554850 · TK1151

Cytoplasm0.091

Rank 2 · TkA02G554850 · TK1151

Cell membrane0.022

Rank 3 · TkA02G554850 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA02G554850 · TK1151

Plastid0.011

Rank 5 · TkA02G554850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30548DciA_cyano_C5-11 aa

PF08961NRBF230-65 aa

PF12824MRP-L2040-122 aa

PF06156YabA42-63 aa

PF00046Homeodomain43-98 aa

PF30548DciA_cyano_C50-65 aa

PF05920Homeobox_KN63-95 aa

PF01527HTH_Tnp_173-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G554850	`PF30548`	DciA_cyano_C	5	11	0.047	14.0
TkA02G554850	`PF08961`	NRBF2	30	65	4.1	7.6
TkA02G554850	`PF12824`	MRP-L20	40	122	0.016	16.1
TkA02G554850	`PF06156`	YabA	42	63	0.25	12.7
TkA02G554850	`PF00046`	Homeodomain	43	98	8.4e-19	67.9
TkA02G554850	`PF30548`	DciA_cyano_C	50	65	0.047	14.0
TkA02G554850	`PF05920`	Homeobox_KN	63	95	6.6e-05	23.4
TkA02G554850	`PF01527`	HTH_Tnp_1	73	120	0.015	16.2
TkA02G554850	`PF04977`	DivIC	93	130	0.27	11.8
TkA02G554850	`PF06156`	YabA	96	120	0.25	12.7
TkA02G554850	`PF28489`	TUSC1	100	160	0.32	11.6
TkA02G554850	`PF07558`	Shugoshin_N	104	121	0.066	13.7
TkA02G554850	`PF08961`	NRBF2	104	125	4.1	7.6
TkA02G554850	`PF17915`	zf_Rg	128	138	0.26	11.4
TkA02G554850	`PF30548`	DciA_cyano_C	129	145	0.047	14.0
TkA02G554850	`PF26237`	DUF8054_C	131	143	0.39	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V99`	Arabidopsis thaliana	sp\|Q93V99\|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 2	69.000%	Swiss-Prot	High
`Q8RWU4`	Arabidopsis thaliana	sp\|Q8RWU4\|ATML1_ARATH Homeobox-leucine zipper protein MERISTEM L1	62.600%	Swiss-Prot	High
`Q94C37`	Arabidopsis thaliana	sp\|Q94C37\|HDG2_ARATH Homeobox-leucine zipper protein HDG2	59.100%	Swiss-Prot	High
`Q0J9X2`	Oryza sativa subsp. japonica	sp\|Q0J9X2\|ROC2_ORYSJ Homeobox-leucine zipper protein ROC2	63.000%	Swiss-Prot	High
`Q6ZAR0`	Oryza sativa subsp. japonica	sp\|Q6ZAR0\|ROC1_ORYSJ Homeobox-leucine zipper protein ROC1	63.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card