TkA02G553210 | RubberDandelionOmics

Gene overview

TkA02G553210

Reference: TK1151 Chr: Chr02 Coordinates: 142765291-142768017 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2310 bp · TkA02G553210|TK1151|cDNA

CTTGGGGCTCTGATAATTTGGTGGAATCTATAACAAACACTCCATCCTCCAAATTTCACCCAATATTTCTTTGTTTCTCTCTCTAGAATTCATATTTGTCTGTTGTATGCCACCGTCTGGTCGGCAACCAGCCTTCAGGTCAGTCACTGTTTCTGTCTTTCTTCCTCTGTGTTGTCACCCTCTGTTTTCTGCTTAAATTCCTCTGCTCCTTGTTGAAAACACACTTCCCTCTCTTCTTTTCTGTCTAATCTCACTCACCA...

CDS

Download CDS FASTA

1674 bp · TkA02G553210|TK1151|CDS

ATGATAAATGTAATGGATCATGTGAATAAACCCATGAATGAAGTAGATAAAAGCTTGGATGGTCAGTTATGGCATGCTTGTGCCGGTGGCATGGTGCAAATGCCGGAATTAAACTCGAAAATATTTTATTTTCCTCAAGGTCATGCCGAACATGCAGCCACCGGCAATGGCGGTTTCCGGGATCTCCCGAGAATCCCGCCGTACATCCTCTGTGGAGTCACCGCCGTCAAGTTCATGGCGGATTCCGACACAGATGAGGT...

Protein

Download Protein FASTA

557 aa · TkA02G553210|TK1151|PROTEIN

MINVMDHVNKPMNEVDKSLDGQLWHACAGGMVQMPELNSKIFYFPQGHAEHAATGNGGFRDLPRIPPYILCGVTAVKFMADSDTDEVYAKIGLVPLGNHRDCDFDNDGLLGFDHIKNENQEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYTAEPPVQTILAKDVHGKLWKFRHIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFLRADNGDLCVGIRRAKRGIGRGFVDANSSGWNTTIPGFGNSGKVTAES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G553210`
TK1151 ID	TkA02G553210
OH-1004 ID	LXL04_005008
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.500
Protein coverage (%)	TK1151 99.282 / OH-1004 90.795 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G553210

Location Chr02:142765291-142768017 (+)

Description Similar to ARF18: Auxin response factor 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28350`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`At4g30080`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0685700`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os10g0479900`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os02g0628600`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005008 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009743 response to carbohydrate Biological Process

GO:0010154 fruit development Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0048366 leaf development Biological Process

GO:0048441 petal development Biological Process

GO:0048442 sepal development Biological Process

KEGG gene cross-reference

ath:AT2G28350

ath:AT4G30080

dosa:Os02g0628600

dosa:Os06g0685700

dosa:Os10g0479900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA02G553210 · TK1151

Cytoplasm0.077

Rank 2 · TkA02G553210 · TK1151

Cell membrane0.025

Rank 3 · TkA02G553210 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA02G553210 · TK1151

Plastid0.013

Rank 5 · TkA02G553210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B332-51 aa

PF25313BRWD_AD34-51 aa

PF02362B3126-227 aa

PF25313BRWD_AD268-371 aa

PF06507ARF_AD287-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G553210	`PF02362`	B3	32	51	2.4e-23	82.7
TkA02G553210	`PF25313`	BRWD_AD	34	51	8.6e-11	42.8
TkA02G553210	`PF02362`	B3	126	227	2.4e-23	82.7
TkA02G553210	`PF25313`	BRWD_AD	268	371	8.6e-11	42.8
TkA02G553210	`PF06507`	ARF_AD	287	370	1.6e-34	118.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN5`	Arabidopsis thaliana	sp\|Q9SKN5\|ARFJ_ARATH Auxin response factor 10	57.000%	Swiss-Prot	High
`Q93YR9`	Arabidopsis thaliana	sp\|Q93YR9\|ARFP_ARATH Auxin response factor 16	50.700%	Swiss-Prot	High
`Q653H7`	Oryza sativa subsp. japonica	sp\|Q653H7\|ARFR_ORYSJ Auxin response factor 18	49.700%	Swiss-Prot	Medium
`Q9AV47`	Oryza sativa subsp. japonica	sp\|Q9AV47\|ARFV_ORYSJ Auxin response factor 22	51.400%	Swiss-Prot	High
`Q6K223`	Oryza sativa subsp. japonica	sp\|Q6K223\|ARFH_ORYSJ Auxin response factor 8	54.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card