TkA02G550350 | RubberDandelionOmics

Gene overview

TkA02G550350

Reference: TK1151 Chr: Chr02 Coordinates: 141990119-141991089 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

806 bp · TkA02G550350|TK1151|cDNA

ATTTCTCATAAAACATCTTCAGACAACAACTTAATCGGAAAAATCGTAGAGGCATTCTCTTTTCGTCAGGTTCAAAATTTTTAATTTAGTCTTTCAATAGTGAAATGGAGGCCGGAACAAAGGTGAAAAAGGGTGCCGCTGGAAGGAAGGCCGGTGGCCCTAAGAAGAAGCCGGTTTCCCGCTCCGTCAAGGCCGGTCTTCAGTTCCCCGTCGGAAGGTTAGGTCGTTACCTCAAGAAAGGCCAGTATGCAAAGCGTGTC...

CDS

Download CDS FASTA

453 bp · TkA02G550350|TK1151|CDS

ATGGAGGCCGGAACAAAGGTGAAAAAGGGTGCCGCTGGAAGGAAGGCCGGTGGCCCTAAGAAGAAGCCGGTTTCCCGCTCCGTCAAGGCCGGTCTTCAGTTCCCCGTCGGAAGGTTAGGTCGTTACCTCAAGAAAGGCCAGTATGCAAAGCGTGTCGGTACCGGTGCTCCGGTTTACCTCGCCGCCGTCCTTGAGTACCTTGCTGCTGAGGTTTTGGAGTTGGCTGGAAATGCTGCAAGAGACAACAAGAAAACCAGAAT...

Protein

Download Protein FASTA

150 aa · TkA02G550350|TK1151|PROTEIN

MEAGTKVKKGAAGRKAGGPKKKPVSRSVKAGLQFPVGRLGRYLKKGQYAKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPILLPKKALEKATKEPKSPSKATKSPKKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G550350`
TK1151 ID	TkA02G550350
OH-1004 ID	LXL04_000533
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.300
Protein coverage (%)	TK1151 100.000 / OH-1004 97.351 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G550350

Location Chr02:141990119-141991089 (+)

Description Similar to Histone H2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02560`	Core component of nucleosome.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WQG7`	Core component of nucleosome.	No verified direct reference in this release
`UniProt: Q94E96`	Core component of nucleosome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000533 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0070828 heterochromatin organization Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000786 nucleosome Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT5G02560

mtr:11418081

sly:101250163

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkA02G550350 · TK1151

Cytoplasm0.073

Rank 2 · TkA02G550350 · TK1151

Extracellular0.015

Rank 3 · TkA02G550350 · TK1151

Cell membrane0.013

Rank 4 · TkA02G550350 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA02G550350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125Histone20-97 aa

PF26281Histone_ABTB23-62 aa

PF00808CBFD_NFYB_HMF33-96 aa

PF22703Cdc6_lid68-93 aa

PF02861Clp_N69-106 aa

PF16211Histone_H2A_C100-133 aa

PF00808CBFD_NFYB_HMF127-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G550350	`PF00125`	Histone	20	97	5.8e-12	46.5
TkA02G550350	`PF26281`	Histone_ABTB	23	62	0.0014	19.0
TkA02G550350	`PF00808`	CBFD_NFYB_HMF	33	96	0.0025	18.8
TkA02G550350	`PF22703`	Cdc6_lid	68	93	0.16	12.6
TkA02G550350	`PF02861`	Clp_N	69	106	0.042	14.8
TkA02G550350	`PF16211`	Histone_H2A_C	100	133	9.2e-18	64.4
TkA02G550350	`PF00808`	CBFD_NFYB_HMF	127	136	0.0025	18.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ46`	Arabidopsis thaliana	sp\|Q9LZ46\|H2A4_ARATH Probable histone H2A.4	86.900%	Swiss-Prot	High
`A2WQG7`	Oryza sativa subsp. indica	sp\|A2WQG7\|H2A5_ORYSI Probable histone H2A.5	85.500%	Swiss-Prot	High
`Q94E96`	Oryza sativa subsp. japonica	sp\|Q94E96\|H2A5_ORYSJ Probable histone H2A.5	85.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card