TkA02G548100 | RubberDandelionOmics

Gene overview

TkA02G548100

Reference: TK1151 Chr: Chr02 Coordinates: 141459069-141461533 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1668 bp · TkA02G548100|TK1151|cDNA

ATGGCTGTAACTAGTGATGCACAAATTGTCAGACGATCAGCAAACTATCCCCCTTCCATATGGTCCTATTCTTATCTCCAATCACTGACTAATAACTATGTGGGTGAAAAATATGAGACAATGTCACATAGTTTGATAGAAGCCGTGAGGAAGATGATTTCTGAAGATGGTGCCGTGCAGGACCCTTTGAGTACACTTGAATTAGTTGATGATATTCAGAGGCTTGGAGTATCTTATCACTTCAGAGATGAAATAAGCAT...

CDS

Download CDS FASTA

1668 bp · TkA02G548100|TK1151|CDS

ATGGCTGTAACTAGTGATGCACAAATTGTCAGACGATCAGCAAACTATCCCCCTTCCATATGGTCCTATTCTTATCTCCAATCACTGACTAATAACTATGTGGGTGAAAAATATGAGACAATGTCACATAGTTTGATAGAAGCCGTGAGGAAGATGATTTCTGAAGATGGTGCCGTGCAGGACCCTTTGAGTACACTTGAATTAGTTGATGATATTCAGAGGCTTGGAGTATCTTATCACTTCAGAGATGAAATAAGCAT...

Protein

Download Protein FASTA

555 aa · TkA02G548100|TK1151|PROTEIN

MAVTSDAQIVRRSANYPPSIWSYSYLQSLTNNYVGEKYETMSHSLIEAVRKMISEDGAVQDPLSTLELVDDIQRLGVSYHFRDEISIVLKMIYHCYYEVHENLKKSDLNFRALGFRLLRQHGYHIPQEIFEDIEYEIRNVKSHVPEDIVGMLNLYEASFLAVEGEGILDEAREFITKCLKVILEKNSICNQFMLMLISHALELPLLWRPPRFEAIWFMEAYKMKSDMNSLLLEFAELDFNILQGIHQDDLKYTSRWWDGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G548100`
TK1151 ID	TkA02G548100
OH-1004 ID	LXL04_012633
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 90.148 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G548100`
Location	Chr02:141459069-141461533 (-)
Description	Similar to QH1: R-linalool synthase QH1, chloroplastic (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012633` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009611 response to wounding Biological Process GO:0016102 diterpenoid biosynthetic process Biological Process GO:0033383 geranyl diphosphate metabolic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0009507 chloroplast Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0010334 sesquiterpene synthase activity Molecular Function GO:0034008 R-linalool synthase activity Molecular Function GO:0050550 pinene synthase activity Molecular Function
KEGG gene cross-reference	ag:AAF13356 ag:AAF13357 ag:AAK58723 rcu:8261702 vvi:100232956 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.702

Rank 1 · TkA02G548100 · TK1151

Plastid0.334

Rank 2 · TkA02G548100 · TK1151

Nucleus0.196

Rank 3 · TkA02G548100 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA02G548100 · TK1151

Peroxisome0.045

Rank 5 · TkA02G548100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01397Terpene_synth20-201 aa

PF03936Terpene_synth_C80-105 aa

PF19086Terpene_syn_C_2121-135 aa

PF10708DUF2510253-263 aa

PF03936Terpene_synth_C260-496 aa

PF19086Terpene_syn_C_2298-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G548100	`PF01397`	Terpene_synth	20	201	4.8e-45	154.3
TkA02G548100	`PF03936`	Terpene_synth_C	80	105	3.7e-77	259.6
TkA02G548100	`PF19086`	Terpene_syn_C_2	121	135	6.4e-52	176.9
TkA02G548100	`PF10708`	DUF2510	253	263	0.29	11.6
TkA02G548100	`PF03936`	Terpene_synth_C	260	496	3.7e-77	259.6
TkA02G548100	`PF19086`	Terpene_syn_C_2	298	497	6.4e-52	176.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card