TkA02G547620 | RubberDandelionOmics

Gene overview

TkA02G547620

Reference: TK1151 Chr: Chr02 Coordinates: 141320525-141323002 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1720 bp · TkA02G547620|TK1151|cDNA

GAAAGTTGATAAATAAGGGTACATCTAAAAATCGTGGAACTTCTATCACCGACTCCGGCCCAAGGTGAGACTTGAGAGAATATAGTACGGTTAGTACCGAAAGGGTAAACGATCAGTTCACACTATTATTAGGGCACACAAACTTCTCAATTCTCATCATTTTTCTCCGACGGAAATCGAATCGTTGAACCTCATCACTCATTAGCTCAATGACGACTCCGGCATCGAATGCGACGACTACACAGACCGACGACCACCAT...

CDS

Download CDS FASTA

603 bp · TkA02G547620|TK1151|CDS

ATGACGACTCCGGCATCGAATGCGACGACTACACAGACCGACGACCACCATGCGAAGACCGTAGACCCTCCTGCCCCGACCACCCAAGACGTGTCCAGCGAGAAATCTCCAGCTTCCTCCACCGACAGGAAAGACGGTGATTCCGGAGAAACAAAGTCGAAAACTATAGATCCGGCTACCGTTACAGCGGACAATAGCAGCGACGATGGTGCTTCAGTTACCGATACTCAGAGGAAGATGCGCCGTGCAGAGCGTTTCGG...

Protein

Download Protein FASTA

200 aa · TkA02G547620|TK1151|PROTEIN

MTTPASNATTTQTDDHHAKTVDPPAPTTQDVSSEKSPASSTDRKDGDSGETKSKTIDPATVTADNSSDDGASVTDTQRKMRRAERFGMPVKLSEEEKRNSRAERFGTTPGSQGTGATKKADELKRKARAERFGIKEATSTEDEEKKKARLSRFGSAPTVADPLEEQKKQARALRFSGTQANGNAKLEPKATVAGKAGGEA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G547620`
TK1151 ID	TkA02G547620
OH-1004 ID	LXL04_029164
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.600
Protein coverage (%)	TK1151 36.500 / OH-1004 57.480 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G547620

Location Chr02:141320525-141323002 (+)

Description Similar to MOS11: Protein MODIFIER OF SNC1 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02770`	Contributes to the transfer of mature mRNA from the nucleus to the cytosol.	MOS11: a new component in the mRNA export pathway.2010 · DOI: 10.1371/journal.pgen.1001250

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029164 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016973 poly(A)+ mRNA export from nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G02770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.650

Rank 1 · TkA02G547620 · TK1151

Cytoplasm0.388

Rank 2 · TkA02G547620 · TK1151

Cell membrane0.040

Rank 3 · TkA02G547620 · TK1151

Mitochondrion0.030

Rank 4 · TkA02G547620 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA02G547620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18592Tho1_MOS11_C75-106 aa

PF10642Tom586-103 aa

PF18592Tho1_MOS11_C124-154 aa

PF18592Tho1_MOS11_C140-175 aa

PF10642Tom5143-149 aa

PF10642Tom5153-170 aa

PF18592Tho1_MOS11_C166-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G547620	`PF18592`	Tho1_MOS11_C	75	106	2.1e-19	69.9
TkA02G547620	`PF10642`	Tom5	86	103	4.0	8.3
TkA02G547620	`PF18592`	Tho1_MOS11_C	124	154	2.1e-19	69.9
TkA02G547620	`PF18592`	Tho1_MOS11_C	140	175	2.1e-19	69.9
TkA02G547620	`PF10642`	Tom5	143	149	4.0	8.3
TkA02G547620	`PF10642`	Tom5	153	170	4.0	8.3
TkA02G547620	`PF18592`	Tho1_MOS11_C	166	178	2.1e-19	69.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ08`	Arabidopsis thaliana	sp\|Q9LZ08\|MOS11_ARATH Protein MODIFIER OF SNC1 11	71.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card