TkA02G546770 | RubberDandelionOmics

Gene overview

TkA02G546770

Reference: TK1151 Chr: Chr02 Coordinates: 141072921-141075993 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2059 bp · TkA02G546770|TK1151|cDNA

CTGCTACAACCAGACGAGGTGGGGTCAATCAAGCAAAACCCAGCTGTTACTTATTCTCCCCTTCATTATCTTGAACCCTTCTTCTCTTGCCGAGATCTGGTTTTCTATCTCTTTCTCAGAGGGGTCCAAACTTTTCTTCTTCCTCTCTGCTCTTTTGTTTTCTGTTCTAAAGATGCCAAAATCAGTCGCCTTGTGATCAAGTACAAGGTGCACGGCGAAGAACAAGACCTCAAAGATCCAAACCAGATTCATTTACTCGT...

CDS

Download CDS FASTA

1368 bp · TkA02G546770|TK1151|CDS

ATGGGTCGGAAAGGCAATTGGTTATCTTCCATTAAAAAGGCTTTGAGTCCAAGCTCCAAAGAAAAGAAAAGCCAGAAATCAAAGAAGAAAGCTTTTGCGGATGAAAAAACTTCAGAACCACCACCGGCAACCGCTCCAATAATAGAAACCGTGAATTCCTATCAGATTCCTCCACCAGAAGAAGTAAAACCAATCGAGGTGGAAGATGAGCAGACAAAACATGCTTATTCAGTTGCAGTTGCTGCCGCCGCTGCAGCTGA...

Protein

Download Protein FASTA

455 aa · TkA02G546770|TK1151|PROTEIN

MGRKGNWLSSIKKALSPSSKEKKSQKSKKKAFADEKTSEPPPATAPIIETVNSYQIPPPEEVKPIEVEDEQTKHAYSVAVAAAAAAEAAATAAQAAAESVRLTELTRYSGKSKEEAAAIRIQTAFRGHLSRRALRALRGLVRLKTLVEGPAVKRQTSNTLKCMQNLSRVQSQINSRRIRMSEENHALQKQLLQKRAKEIESLQMGEEWNDSLQSKEEIEAKLLGKYEATMRRERAMAYSFSHQQPWKKSSRTTNLLFMDP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G546770`
TK1151 ID	TkA02G546770
OH-1004 ID	LXL04_004951
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.600
Protein coverage (%)	TK1151 95.824 / OH-1004 98.756 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G546770

Location Chr02:141072921-141075993 (+)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g52290`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g09710`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins.	Arabidopsis IQD1, a novel calmodulin-binding nuclear protein, stimulates glucosinolate accumulation and plant defense.2005 · DOI: 10.1111/j.1365-313x.2005.02435.x Arabidopsis calmodulin-binding protein IQ67-domain 1 localizes to microtubules and interacts with kinesin light chain-related protein-1.2013 · DOI: 10.1074/jbc.m112.396200
`At2g26410`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g22190`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	The Microtubule-Associated Protein IQ67 DOMAIN5 Modulates Microtubule Dynamics and Pavement Cell Shape.2018 · DOI: 10.1104/pp.18.00558 Microtubule-associated protein IQ67 DOMAIN5 regulates morphogenesis of leaf pavement cells in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery395

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004951 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:2000652 regulation of secondary cell wall biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26410

ath:AT2G43680

ath:AT3G09710

ath:AT3G52290

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA02G546770 · TK1151

Cell membrane0.366

Rank 2 · TkA02G546770 · TK1151

Nucleus0.346

Rank 3 · TkA02G546770 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA02G546770 · TK1151

Plastid0.031

Rank 5 · TkA02G546770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13178DUF400522-30 aa

PF24609IQ_SCN5A_C113-137 aa

PF00612IQ116-135 aa

PF13178DUF4005263-276 aa

PF13178DUF4005363-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G546770	`PF13178`	DUF4005	22	30	4.4e-07	31.1
TkA02G546770	`PF24609`	IQ_SCN5A_C	113	137	0.0057	16.8
TkA02G546770	`PF00612`	IQ	116	135	5.3e-05	23.4
TkA02G546770	`PF13178`	DUF4005	263	276	4.4e-07	31.1
TkA02G546770	`PF13178`	DUF4005	363	423	4.4e-07	31.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZH7`	Arabidopsis thaliana	sp\|Q93ZH7\|IQD2_ARATH Protein IQ-DOMAIN 2	50.900%	Swiss-Prot	High
`Q9FT53`	Arabidopsis thaliana	sp\|Q9FT53\|IQD3_ARATH Protein IQ-DOMAIN 3	49.800%	Swiss-Prot	Medium
`Q9SF32`	Arabidopsis thaliana	sp\|Q9SF32\|IQD1_ARATH Protein IQ-DOMAIN 1	44.300%	Swiss-Prot	Medium
`F4IUJ7`	Arabidopsis thaliana	sp\|F4IUJ7\|IQD4_ARATH Protein IQ-DOMAIN 4	36.900%	Swiss-Prot	Medium
`F4J061`	Arabidopsis thaliana	sp\|F4J061\|IQD5_ARATH Protein IQ-DOMAIN 5	40.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card