TkA02G543870 | RubberDandelionOmics

Gene overview

TkA02G543870

Reference: TK1151 Chr: Chr02 Coordinates: 140268194-140271572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1513 bp · TkA02G543870|TK1151|cDNA

AAGCTGACAAAGTGATCGAGCCACCCTCTCTAAACGGACACGTATAATAAGCCATCCCAATAGCCAACGATAATCCTCTGACAACACGCCGACGCCGGAATGCCTCATCGGAAAACCGAAAATCCGCACGCGATATTTATACCATTTCCGCTCCAAGGTCACCTAATCCCTTCCGTTCTTCTTGCCATCAAGCTAGCATCAAAGGGATTCACCATCACCTTCATCAACACCGAATCAATCCACCATAGTATCACCAAATC...

CDS

Download CDS FASTA

816 bp · TkA02G543870|TK1151|CDS

ATGATGTCATACCTCCAAGCCACTAATACAAACACGGCGCCCCATCGTATCATACACAAGGCATTGTTTGAGGATGCAAGGAAGGCGGATTTCATGATATGTAACACAATACACGAGCTTGAATCTCAAACAATTTCGGTACTTAATCAAATACAATCTTTTTATGCGATTGGTCCTATTTTCCATAACAAGTTCACTGAAAAACTTGTGTCCACAAACTTATGGTATGAGGTAGATTGCACCCGTTGGCTTGATGATAG...

Protein

Download Protein FASTA

272 aa · TkA02G543870|TK1151|PROTEIN

MMSYLQATNTNTAPHRIIHKALFEDARKADFMICNTIHELESQTISVLNQIQSFYAIGPIFHNKFTEKLVSTNLWYEVDCTRWLDDRPLKSVLYISFGSYAHTSKHDLEEIAYGLLQSGVRFVWALRNDIVSSNDTNALPLGFEDQVKDQGLIVPWCDQKTILSHPSIGGFMTHCGWNSVLESIWCGVPLICFPLLTDQFTNRKLVVDDWKVGINLCEGYLVRKEEVTKRVKDLMIGAKSSELRKEMKKIKTTLQDALAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G543870`
TK1151 ID	TkA02G543870
OH-1004 ID	LXL04_012706
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 38.968 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G543870

Location Chr02:140268194-140271572 (+)

Description Similar to UGT86A1: UDP-glycosyltransferase 86A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36970`	UDP-glycosyltransferase 86A1.	No verified direct reference in this release
`At2g28080`	UDP-glycosyltransferase 86A2.	No verified direct reference in this release
`At1g22400`	Involved in the O-glucosylation of trans-zeatin and dihydrozeatin.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012706 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22400

ath:AT2G28080

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · TkA02G543870 · TK1151

Peroxisome0.232

Rank 2 · TkA02G543870 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA02G543870 · TK1151

Nucleus0.098

Rank 4 · TkA02G543870 · TK1151

Plastid0.061

Rank 5 · TkA02G543870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12130bMERB_dom27-55 aa

PF00201UDPGT91-211 aa

PF12130bMERB_dom109-132 aa

PF07249Cerato-platanin150-218 aa

PF04101Glyco_tran_28_C173-249 aa

PF12130bMERB_dom223-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G543870	`PF12130`	bMERB_dom	27	55	0.18	12.6
TkA02G543870	`PF00201`	UDPGT	91	211	1.8e-22	80.5
TkA02G543870	`PF12130`	bMERB_dom	109	132	0.18	12.6
TkA02G543870	`PF07249`	Cerato-platanin	150	218	0.009	16.9
TkA02G543870	`PF04101`	Glyco_tran_28_C	173	249	0.0054	17.5
TkA02G543870	`PF12130`	bMERB_dom	223	260	0.18	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJL0`	Arabidopsis thaliana	sp\|Q9SJL0\|U86A1_ARATH UDP-glycosyltransferase 86A1	55.800%	Swiss-Prot	High
`Q9ZUV0`	Arabidopsis thaliana	sp\|Q9ZUV0\|U86A2_ARATH UDP-glycosyltransferase 86A2	54.000%	Swiss-Prot	High
`Q9SK82`	Arabidopsis thaliana	sp\|Q9SK82\|U85A1_ARATH UDP-glycosyltransferase 85A1	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card