Gene Card
Gene overview
cDNA / CDS / Protein Sequences
345 bp · TkA02G535540|TK1151|cDNA
ATGCTTTCAGCCGGCGATGATTTCGTTATTTCGGCTATTTATACCTTCAGAACATGGTTGAAGAAAGGTACGCCACAGGAGTCACGAAGTGTACGCATTCACAGACAGGAAGAAAGCTTCCCTCCCGATAGTCGAAGTGCCGACTCCCGACTCCCGAATCGGCGAATCCCGATCGAATATCCCAGTTTCAGCTTCACTTGCAGCACCGGCGATGCAATGGGGATGAACATGGTCTCCAAAGGCGTCCAGAACGTTCTAGA...
345 bp · TkA02G535540|TK1151|CDS
ATGCTTTCAGCCGGCGATGATTTCGTTATTTCGGCTATTTATACCTTCAGAACATGGTTGAAGAAAGGTACGCCACAGGAGTCACGAAGTGTACGCATTCACAGACAGGAAGAAAGCTTCCCTCCCGATAGTCGAAGTGCCGACTCCCGACTCCCGAATCGGCGAATCCCGATCGAATATCCCAGTTTCAGCTTCACTTGCAGCACCGGCGATGCAATGGGGATGAACATGGTCTCCAAAGGCGTCCAGAACGTTCTAGA...
Protein
Download Protein FASTA114 aa · TkA02G535540|TK1151|PROTEIN
MLSAGDDFVISAIYTFRTWLKKGTPQESRSVRIHRQEESFPPDSRSADSRLPNRRIPIEYPSFSFTCSTGDAMGMNMVSKGVQNVLDFLQIDFPDMGVIGISGRSSNSSKSFND
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G535540 |
|---|---|
| TK1151 ID | TkA02G535540 |
| OH-1004 ID | LXL04_022221 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 84.800 |
| Protein coverage (%) | TK1151 40.351 / OH-1004 7.088Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G535540 |
|---|---|
| Location | Chr02:138100407-138101135 (+) |
| Description | Similar to HMGR1: 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0008299 isoprenoid biosynthetic process Biological Process GO:0009646 response to absence of light Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0015936 coenzyme A metabolic process Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process GO:0005778 peroxisomal membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component |
| KEGG gene cross-reference | ath:AT1G76490 nsy:104230282 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00368HMG-CoA_red54-109 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G535540 | PF00368 | HMG-CoA_red | 54 | 109 | 6e-10 | 39.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.