TkA02G532800 | RubberDandelionOmics

Gene overview

TkA02G532800

Reference: TK1151 Chr: Chr02 Coordinates: 137333135-137333902 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

621 bp · TkA02G532800|TK1151|cDNA

TCCTCTCTCACACTACTCTGTGTGGGTGTTGTGTCTCTGGTAAGTCAATGGAGAGCACCGCAGAATCCCCACTTCTTACCTCAAAAATGCCACACACAATGCTCACTTCACCGGCGACGTCGAAGATATCCATCCGATCAACGGGTTAAAAGATTTCGCTGTCTAGTTTGGAATCGAATCAAAGAAGCTCTGGTACCTTGCCGCCCCTGCGATTTTCACTTCCGTTTGCCAGTACTCACTAGGTGCCATCACGCAAACGT...

CDS

Download CDS FASTA

621 bp · TkA02G532800|TK1151|CDS

TCCTCTCTCACACTACTCTGTGTGGGTGTTGTGTCTCTGGTAAGTCAATGGAGAGCACCGCAGAATCCCCACTTCTTACCTCAAAAATGCCACACACAATGCTCACTTCACCGGCGACGTCGAAGATATCCATCCGATCAACGGGTTAAAAGATTTCGCTGTCTAGTTTGGAATCGAATCAAAGAAGCTCTGGTACCTTGCCGCCCCTGCGATTTTCACTTCCGTTTGCCAGTACTCACTAGGTGCCATCACGCAAACGT...

Protein

Download Protein FASTA

207 aa · TkA02G532800|TK1151|PROTEIN

SSLTLLCVGVVSLVSQWRAPQNPHFLPQKCHTQCSLHRRRRRYPSDQRVKRFRCLVWNRIKEALVPCRPCDFHFRLPVLTRCHHANVCGHVGTLDLAAVSIENSVIAGFSLGIMLGMGSALETLCGQAFGAGQVDMLGVYMQRSWVILFVTGLIMLPLYIFATPLLLLIGQTEDISKAAGQMALWMIPQLFAYAFNYPIAKFLQAQS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G532800`
TK1151 ID	TkA02G532800
OH-1004 ID	LXL04_031584
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.400
Protein coverage (%)	TK1151 57.488 / OH-1004 23.944 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G532800

Location Chr02:137333135-137333902 (+)

Description Similar to DTX29: Protein DETOXIFICATION 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47530`	Protein DETOXIFICATION 33.	No verified direct reference in this release
`At1g23300`	Protein DETOXIFICATION 32.	No verified direct reference in this release
`At3g26590`	Protein DETOXIFICATION 29.	No verified direct reference in this release
`At5g38030`	Protein DETOXIFICATION 30.	No verified direct reference in this release
`At1g12950`	Positively mediates root hair elongation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0048767 root hair elongation Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G12950

ath:AT1G23300

ath:AT1G47530

ath:AT3G26590

ath:AT5G38030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.361

Rank 1 · TkA02G532800 · TK1151

Lysosome / Vacuole0.210

Rank 2 · TkA02G532800 · TK1151

Golgi apparatus0.191

Rank 3 · TkA02G532800 · TK1151

Cell membrane0.173

Rank 4 · TkA02G532800 · TK1151

Cytoplasm0.128

Rank 5 · TkA02G532800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE87-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G532800	`PF01554`	MatE	87	206	2.6e-27	96.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX83`	Arabidopsis thaliana	sp\|Q9SX83\|DTX33_ARATH Protein DETOXIFICATION 33	69.500%	Swiss-Prot	Medium
`F4I4Q3`	Arabidopsis thaliana	sp\|F4I4Q3\|DTX32_ARATH Protein DETOXIFICATION 32	69.400%	Swiss-Prot	Medium
`Q38956`	Arabidopsis thaliana	sp\|Q38956\|DTX29_ARATH Protein DETOXIFICATION 29	72.300%	Swiss-Prot	Medium
`Q9LS19`	Arabidopsis thaliana	sp\|Q9LS19\|DTX30_ARATH Protein DETOXIFICATION 30	71.400%	Swiss-Prot	Medium
`Q9LPV4`	Arabidopsis thaliana	sp\|Q9LPV4\|DTX31_ARATH Protein DETOXIFICATION 31	73.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card