TkA02G531450 | RubberDandelionOmics

Gene overview

TkA02G531450

Reference: TK1151 Chr: Chr02 Coordinates: 137004587-137012503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4278 bp · TkA02G531450|TK1151|cDNA

ATGGACAAGTCTTGGATGGGATCACAAAGAAATAGACAACCTTATATGAGGGGAGTTGAAGAATTTTTGGAATATGCGGTTTCAAACTTCAAGCTTTCTAACAACATCGATCCTCTAGGTCACAGAAAAAAAATAGAAATTCCATGTCCATGTATCAAGTGTGTGAACCACTTACCTCATTCGGTGCAATTGGTACGTGATCACTTAATCACACATGGAATTGATGAAACCTACACGAACTGGACATATCATGGAGAACA...

CDS

Download CDS FASTA

4278 bp · TkA02G531450|TK1151|CDS

ATGGACAAGTCTTGGATGGGATCACAAAGAAATAGACAACCTTATATGAGGGGAGTTGAAGAATTTTTGGAATATGCGGTTTCAAACTTCAAGCTTTCTAACAACATCGATCCTCTAGGTCACAGAAAAAAAATAGAAATTCCATGTCCATGTATCAAGTGTGTGAACCACTTACCTCATTCGGTGCAATTGGTACGTGATCACTTAATCACACATGGAATTGATGAAACCTACACGAACTGGACATATCATGGAGAACA...

Protein

Download Protein FASTA

1425 aa · TkA02G531450|TK1151|PROTEIN

MDKSWMGSQRNRQPYMRGVEEFLEYAVSNFKLSNNIDPLGHRKKIEIPCPCIKCVNHLPHSVQLVRDHLITHGIDETYTNWTYHGEQYDPPLPYIVDDDFDMDTSYVVDSMDDTTEKPTDAAETEELVQAAEELFMDDPTKFREMLEDAEKPLYEGCPDFTKLSAIIQLLNLKSKYGVSDKFFTELLILVKKMLPEGNEMYSGTYEAKKAFKQLGSGYEKIHACVNRCILYRHEYEHLTECPDCGKSRWKVDEQKNKIYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G531450`
TK1151 ID	TkA02G531450
OH-1004 ID	LXL04_039589
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.200
Protein coverage (%)	TK1151 96.421 / OH-1004 94.780 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G531450

Location Chr02:137004587-137012503 (-)

Description Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34450`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0201100`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os03g0227000`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039589 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0042393 histone binding Molecular Function

GO:0140566 histone reader activity Molecular Function

KEGG gene cross-reference

ath:AT1G09320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.888

Rank 1 · TkA02G531450 · TK1151

Cytoplasm0.179

Rank 2 · TkA02G531450 · TK1151

Mitochondrion0.024

Rank 3 · TkA02G531450 · TK1151

Cell membrane0.021

Rank 4 · TkA02G531450 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA02G531450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13963Transpos_assoc3-86 aa

PF09675Chlamy_scaf113-169 aa

PF29880DUF8594235-259 aa

PF02992Transposase_21301-507 aa

PF09675Chlamy_scaf571-590 aa

PF13960DUF4218716-821 aa

PF29880DUF8594995-1014 aa

PF13952DUF4216997-1060 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G531450	`PF13963`	Transpos_assoc	3	86	6.5e-17	62.2
TkA02G531450	`PF09675`	Chlamy_scaf	113	169	0.1	13.4
TkA02G531450	`PF29880`	DUF8594	235	259	2.0	8.7
TkA02G531450	`PF02992`	Transposase_21	301	507	4.1e-81	272.0
TkA02G531450	`PF09675`	Chlamy_scaf	571	590	0.1	13.4
TkA02G531450	`PF13960`	DUF4218	716	821	1.8e-40	138.0
TkA02G531450	`PF29880`	DUF8594	995	1014	2.0	8.7
TkA02G531450	`PF13952`	DUF4216	997	1060	8.7e-21	75.0
TkA02G531450	`PF01602`	Adaptin_N	1199	1273	2.1e-10	40.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WW26`	Arabidopsis thaliana	sp\|Q0WW26\|COPG_ARATH Coatomer subunit gamma	61.100%	Swiss-Prot	Low
`Q6Z382`	Oryza sativa subsp. japonica	sp\|Q6Z382\|COPG2_ORYSJ Coatomer subunit gamma-2	60.300%	Swiss-Prot	Low
`Q8H852`	Oryza sativa subsp. japonica	sp\|Q8H852\|COPG1_ORYSJ Coatomer subunit gamma-1	58.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card