TkA02G525530 | RubberDandelionOmics

Gene overview

TkA02G525530

Reference: TK1151 Chr: Chr02 Coordinates: 135543355-135545495 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1439 bp · TkA02G525530|TK1151|cDNA

CTGACGCCACACGTCATCGCACGTATTACATTGGCTGCGCCGAGCTTCTTCCGAAAGCTTCACTTTTGAATTATTTCGTCTCTTTCTCTCTCTCTCCCTCTCTCTCTGTCTCCATCGTTGGGTTTTTCGACTTCCTGTAGTAGAAGCAAATCCGCATCAATGTCGGTAAACGATGATCGGAAGAAGCGGCCAAAAAGGGAGTATCCAGATTTTAATGATATCCATCCAGATCAGCCCAACGATCAAAGCTTTAAGCAGCG...

CDS

Download CDS FASTA

1056 bp · TkA02G525530|TK1151|CDS

ATGTCGGTAAACGATGATCGGAAGAAGCGGCCAAAAAGGGAGTATCCAGATTTTAATGATATCCATCCAGATCAGCCCAACGATCAAAGCTTTAAGCAGCGCAGAGTTCTTCGTTCCGGATACCTTTCAATCCAAAGTTACATTCGCGATAGAACAGATGCTATAGCCGCCACTGATTCGAAAAAGTTCATCTCCATTATCGACGAAGTCGATGAAATGCATCATCGAGTCACTAAACCAAGAGAGCAAGTATCAGACGC...

Protein

Download Protein FASTA

351 aa · TkA02G525530|TK1151|PROTEIN

MSVNDDRKKRPKREYPDFNDIHPDQPNDQSFKQRRVLRSGYLSIQSYIRDRTDAIAATDSKKFISIIDEVDEMHHRVTKPREQVSDAEALRELANSLVTSIKVHSAGSVTPSLFVSCLITEFGGKEGTGLNDSTQIRWKDIGLHVSPLFMTFQGSCTMLGHMKQDKKPSNTLATRKRPRSSVKEEKVKPEEIEETTSKENKDTERIIATMFDILKTKKKVSLENIILNRISFAQTVENLFALSFLVKDGRVVITVDDKGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G525530`
TK1151 ID	TkA02G525530
OH-1004 ID	LXL04_000413
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.700
Protein coverage (%)	TK1151 82.906 / OH-1004 77.184 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G525530

Location Chr02:135543355-135545495 (+)

Description Similar to NSE4A: Non-structural maintenance of chromosomes element 4 homolog A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51130`	Component of the SMC5-SMC6 complex, that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids.	No verified direct reference in this release
`At3g20760`	Component of the SMC5-SMC6 complex, that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000413 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0140588 chromatin looping Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G51130

ath:AT3G20760

bta:527312

hsa:54780

spo:3361330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.884

Rank 1 · TkA02G525530 · TK1151

Cytoplasm0.187

Rank 2 · TkA02G525530 · TK1151

Cell membrane0.020

Rank 3 · TkA02G525530 · TK1151

Mitochondrion0.012

Rank 4 · TkA02G525530 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA02G525530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29556DUF85628-118 aa

PF14397ATPgrasp_ST183-263 aa

PF08743Nse4_C185-205 aa

PF08743Nse4_C220-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G525530	`PF29556`	DUF8562	8	118	0.27	10.3
TkA02G525530	`PF14397`	ATPgrasp_ST	183	263	0.18	11.6
TkA02G525530	`PF08743`	Nse4_C	185	205	1.3e-21	77.3
TkA02G525530	`PF08743`	Nse4_C	220	301	1.3e-21	77.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C689`	Arabidopsis thaliana	sp\|Q9C689\|NSE4A_ARATH Non-structural maintenance of chromosomes element 4 homolog A	46.100%	Swiss-Prot	Medium
`F4JET1`	Arabidopsis thaliana	sp\|F4JET1\|NSE4B_ARATH Non-structural maintenance of chromosomes element 4 homolog B	45.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card