TkA02G525440 | RubberDandelionOmics

Gene overview

TkA02G525440

Reference: TK1151 Chr: Chr02 Coordinates: 135520780-135522563 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · TkA02G525440|TK1151|cDNA

ATGAAAAACCACTACGACTACTTCAAAGCTAAGTATGTAGCTTGGGTGAAACTTAAAAACAAAACAGGCAACATTTATAATCCTATAACAAATTCTTTTAATATGACTGATGAAGAGTGGGAGATGGAGGGAAAGTTGAACAAGTTTGTAGAGAAATTGAGAAGCGCACCCCTCCTTCTCCCTCACCTTTGCATCCAGTTATTTGAAGGGTCGGCCTCGAACGGTTGTGACAGTTACGGGCCATCTTTTAGAGTCCCTCA...

CDS

Download CDS FASTA

1368 bp · TkA02G525440|TK1151|CDS

ATGAAAAACCACTACGACTACTTCAAAGCTAAGTATGTAGCTTGGGTGAAACTTAAAAACAAAACAGGCAACATTTATAATCCTATAACAAATTCTTTTAATATGACTGATGAAGAGTGGGAGATGGAGGGAAAGTTGAACAAGTTTGTAGAGAAATTGAGAAGCGCACCCCTCCTTCTCCCTCACCTTTGCATCCAGTTATTTGAAGGGTCGGCCTCGAACGGTTGTGACAGTTACGGGCCATCTTTTAGAGTCCCTCA...

Protein

Download Protein FASTA

455 aa · TkA02G525440|TK1151|PROTEIN

MKNHYDYFKAKYVAWVKLKNKTGNIYNPITNSFNMTDEEWEMEGKLNKFVEKLRSAPLLLPHLCIQLFEGSASNGCDSYGPSFRVPHHAEEDTVDDCDSTQMEAPTSTQHAGGSDESPGHSKDKGAKGKLKRDARVIEVEEEIIKVARSLVEQNDMDKDMDACMEKLEKMDWGEEDPRYETALLLFGESADIRKVWLRLKSSSCESWVRNAGRKLHMASDGQILAFLLLVCHWLKLNRQRLNRIHRIRDNEPVASGYAYT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G525440`
TK1151 ID	TkA02G525440
OH-1004 ID	LXL04_029606
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.600
Protein coverage (%)	TK1151 91.868 / OH-1004 57.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G525440`
Location	Chr02:135520780-135522563 (-)
Description	Similar to LIMYB: L10-interacting MYB domain-containing protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029606` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function
KEGG gene cross-reference	ath:AT5G05800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.881

Rank 1 · TkA02G525440 · TK1151

Cytoplasm0.168

Rank 2 · TkA02G525440 · TK1151

Mitochondrion0.025

Rank 3 · TkA02G525440 · TK1151

Cell membrane0.024

Rank 4 · TkA02G525440 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA02G525440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12776Myb_DNA-bind_31-41 aa

PF12776Myb_DNA-bind_3145-170 aa

PF26138DUF8040216-233 aa

PF26138DUF8040255-280 aa

PF26138DUF8040281-312 aa

PF13359DDE_Tnp_4286-306 aa

PF13359DDE_Tnp_4348-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G525440	`PF12776`	Myb_DNA-bind_3	1	41	0.0082	17.8
TkA02G525440	`PF12776`	Myb_DNA-bind_3	145	170	0.0082	17.8
TkA02G525440	`PF26138`	DUF8040	216	233	8.6e-13	48.7
TkA02G525440	`PF26138`	DUF8040	255	280	8.6e-13	48.7
TkA02G525440	`PF26138`	DUF8040	281	312	8.6e-13	48.7
TkA02G525440	`PF13359`	DDE_Tnp_4	286	306	0.0011	19.4
TkA02G525440	`PF13359`	DDE_Tnp_4	348	408	0.0011	19.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card