TkA02G523110 | RubberDandelionOmics

Gene overview

TkA02G523110

Reference: TK1151 Chr: Chr02 Coordinates: 134888015-134891484 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · TkA02G523110|TK1151|cDNA

ATGAATCACGAACAGCATCATCATCCTCGGTCAAAGAATCACGGCCCTGAGGTCTTCTGGCCGAAAATCATTATCCAAAAATGGCTAAATCGTGCCTCTAAAAGTTCCGATTACACCGCCGATCCGGAGGACGAAGATAGCACATACGATTCCGAGGGCGAAGAAGACTCCTACGACTCCCCAAAAGAACTGCGACTGAAGGTTAAACAAGGAGATGATTTCCAAACCGATCCCAGTGTTATGAATGAGCGTGAAATGGA...

CDS

Download CDS FASTA

921 bp · TkA02G523110|TK1151|CDS

ATGAATCACGAACAGCATCATCATCCTCGGTCAAAGAATCACGGCCCTGAGGTCTTCTGGCCGAAAATCATTATCCAAAAATGGCTAAATCGTGCCTCTAAAAGTTCCGATTACACCGCCGATCCGGAGGACGAAGATAGCACATACGATTCCGAGGGCGAAGAAGACTCCTACGACTCCCCAAAAGAACTGCGACTGAAGGTTAAACAAGGAGATGATTTCCAAACCGATCCCAGTGTTATGAATGAGCGTGAAATGGA...

Protein

Download Protein FASTA

306 aa · TkA02G523110|TK1151|PROTEIN

MNHEQHHHPRSKNHGPEVFWPKIIIQKWLNRASKSSDYTADPEDEDSTYDSEGEEDSYDSPKELRLKVKQGDDFQTDPSVMNEREMEIGYPTDVKHVAHIGWDGSSGSAPSWVIWSGLQAIFSPPTAVRGGIPIIFSQGIRRIARKEDLLTILRQHVKSNVLHIDNKFYLQNDELITCLLKSGADPNVIDEEGWKPVQVAALRGNRGAVEVLFPMDVDVYTQETLLDKAGASCQALTDAQACRELKPNWAKAWYREGAAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G523110`
TK1151 ID	TkA02G523110
OH-1004 ID	LXL04_027673
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G523110

Location Chr02:134888015-134891484 (+)

Description Similar to RIC10: CRIB domain-containing protein RIC10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61795`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At4g04900`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	A genome-wide analysis of Arabidopsis Rop-interactive CRIB motif-containing proteins that act as Rop GTPase targets.2001 · DOI: 10.1105/tpc.010218
`At3g23380`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At4g21745`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At4g28556`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0031122 cytoplasmic microtubule organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

GO:0016324 apical plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G33460

ath:AT3G23380

ath:AT4G04900

ath:AT4G21745

ath:AT4G28556

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.403

Rank 1 · TkA02G523110 · TK1151

Nucleus0.374

Rank 2 · TkA02G523110 · TK1151

Cell membrane0.139

Rank 3 · TkA02G523110 · TK1151

Mitochondrion0.124

Rank 4 · TkA02G523110 · TK1151

Endoplasmic reticulum0.084

Rank 5 · TkA02G523110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00786PBD87-108 aa

PF13637Ank_4171-212 aa

PF12796Ank_2172-229 aa

PF13606Ank_3172-188 aa

PF00023Ank172-190 aa

PF13857Ank_5179-200 aa

PF13857Ank_5179-229 aa

PF13606Ank_3192-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G523110	`PF00786`	PBD	87	108	2.9e-06	28.2
TkA02G523110	`PF13637`	Ank_4	171	212	1.7e-05	25.7
TkA02G523110	`PF12796`	Ank_2	172	229	0.00019	22.7
TkA02G523110	`PF13606`	Ank_3	172	188	0.27	12.7
TkA02G523110	`PF00023`	Ank	172	190	0.3	12.2
TkA02G523110	`PF13857`	Ank_5	179	200	0.0045	18.1
TkA02G523110	`PF13857`	Ank_5	179	229	0.0045	18.1
TkA02G523110	`PF13606`	Ank_3	192	220	0.27	12.7
TkA02G523110	`PF00023`	Ank	193	212	0.3	12.2
TkA02G523110	`PF07916`	TraG_N	234	302	0.0032	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3Y0`	Arabidopsis thaliana	sp\|Q1G3Y0\|RIC9_ARATH CRIB domain-containing protein RIC9	76.500%	Swiss-Prot	Low
`Q9M0Y9`	Arabidopsis thaliana	sp\|Q9M0Y9\|RIC10_ARATH CRIB domain-containing protein RIC10	82.800%	Swiss-Prot	Low
`F4J424`	Arabidopsis thaliana	sp\|F4J424\|RIC5_ARATH CRIB domain-containing protein RIC5	71.000%	Swiss-Prot	Low
`Q0WL69`	Arabidopsis thaliana	sp\|Q0WL69\|RIC11_ARATH CRIB domain-containing protein RIC11	62.500%	Swiss-Prot	Low
`Q1G3K8`	Arabidopsis thaliana	sp\|Q1G3K8\|RIC7_ARATH CRIB domain-containing protein RIC7	72.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card