TkA02G520590 | RubberDandelionOmics

Gene overview

TkA02G520590

Reference: TK1151 Chr: Chr02 Coordinates: 134244268-134244768 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA02G520590|TK1151|cDNA

ATGCCGCCAAAGTTTGATCCGTCACAAGTCGTCGACGTTTATGTCCGCGTCACTGGTGGTGAGGTCGGAGCGGCGAGTTCCCTCGCTCCGAAGATCGGACCACTCGGTCTCTCTCCTAAGAAGATCGGAGAAGACATAGCTAAGGAAACGGCTAAGGACTGGAAGGGTCTTAGAGTCACCGTCAAGCTTACAGTACAGAATCGTCAAGCTAAGGTTTCCGTTGTCCCCTCCGCCGCTGCATTGGTTATTAAAGCGCTCAA...

CDS

Download CDS FASTA

381 bp · TkA02G520590|TK1151|CDS

ATGCCGCCAAAGTTTGATCCGTCACAAGTCGTCGACGTTTATGTCCGCGTCACTGGTGGTGAGGTCGGAGCGGCGAGTTCCCTCGCTCCGAAGATCGGACCACTCGGTCTCTCTCCTAAGAAGATCGGAGAAGACATAGCTAAGGAAACGGCTAAGGACTGGAAGGGTCTTAGAGTCACCGTCAAGCTTACAGTACAGAATCGTCAAGCTAAGGTTTCCGTTGTCCCCTCCGCCGCTGCATTGGTTATTAAAGCGCTCAA...

Protein

Download Protein FASTA

126 aa · TkA02G520590|TK1151|PROTEIN

MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTCVSVGCTVDGKDPKDLQEEIADGDVEIPQD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G520590`
TK1151 ID	TkA02G520590
OH-1004 ID	LXL04_013041
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G520590

Location Chr02:134244268-134244768 (+)

Description Similar to RPL12: 60S ribosomal protein L12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37190`	Binds directly to 26S ribosomal RNA.	No verified direct reference in this release
`At3g53430`	Binds directly to 26S ribosomal RNA.	No verified direct reference in this release
`At5g60670`	Binds directly to 26S ribosomal RNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013041 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0180023 cytosolic large ribosomal subunit assembly Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT2G37190

ath:AT3G53430

ath:AT5G60670

spo:2539010

spo:2539186

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.868

Rank 1 · TkA02G520590 · TK1151

Nucleus0.246

Rank 2 · TkA02G520590 · TK1151

Endoplasmic reticulum0.106

Rank 3 · TkA02G520590 · TK1151

Mitochondrion0.066

Rank 4 · TkA02G520590 · TK1151

Cell membrane0.056

Rank 5 · TkA02G520590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03946Ribosomal_L11_N13-70 aa

PF12642TpcC38-114 aa

PF00298Ribosomal_L1145-55 aa

PF28393Ig_Cad99C_N58-106 aa

PF00298Ribosomal_L1175-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G520590	`PF03946`	Ribosomal_L11_N	13	70	3.6e-20	72.2
TkA02G520590	`PF12642`	TpcC	38	114	0.11	13.1
TkA02G520590	`PF00298`	Ribosomal_L11	45	55	0.063	14.4
TkA02G520590	`PF28393`	Ig_Cad99C_N	58	106	0.093	13.3
TkA02G520590	`PF00298`	Ribosomal_L11	75	101	0.063	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P50883`	Arabidopsis thaliana	sp\|P50883\|RL121_ARATH Large ribosomal subunit protein uL11z	69.700%	Swiss-Prot	High
`Q9LFH5`	Arabidopsis thaliana	sp\|Q9LFH5\|RL122_ARATH Large ribosomal subunit protein uL11y	69.100%	Swiss-Prot	High
`Q9FF52`	Arabidopsis thaliana	sp\|Q9FF52\|RL123_ARATH Large ribosomal subunit protein uL11x	70.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card