TkA02G519380 | RubberDandelionOmics

Gene overview

TkA02G519380

Reference: TK1151 Chr: Chr02 Coordinates: 133852456-133857481 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2436 bp · TkA02G519380|TK1151|cDNA

ATGGAAGGTGACGACATATGGTGTCGCACCGAAGGTCCGGAAGCTCGCCGGTATGGAGATTTCAGCGCACGCGGATCCGAAATACAGGGTAGAAGCGTCATTTCAGGTCCAACCCCTTATTTATCGCGGGAATTGAAAGAGTCGTCTGCTTTTTCTCAACATTCCGTGGTCGCAGCTTCCATTTCTTCTTACTGTTACTCGATAAACCTTTTGAAGAGATTACAGGTGATTGTGAAAGTAACCATGGTGCTAACTATCTG...

CDS

Download CDS FASTA

2436 bp · TkA02G519380|TK1151|CDS

ATGGAAGGTGACGACATATGGTGTCGCACCGAAGGTCCGGAAGCTCGCCGGTATGGAGATTTCAGCGCACGCGGATCCGAAATACAGGGTAGAAGCGTCATTTCAGGTCCAACCCCTTATTTATCGCGGGAATTGAAAGAGTCGTCTGCTTTTTCTCAACATTCCGTGGTCGCAGCTTCCATTTCTTCTTACTGTTACTCGATAAACCTTTTGAAGAGATTACAGGTGATTGTGAAAGTAACCATGGTGCTAACTATCTG...

Protein

Download Protein FASTA

811 aa · TkA02G519380|TK1151|PROTEIN

MEGDDIWCRTEGPEARRYGDFSARGSEIQGRSVISGPTPYLSRELKESSAFSQHSVVAASISSYCYSINLLKRLQVIVKVTMVLTIWELRKGLKHPDLDKAYEDTDNYFTLKLYYGGVFTKIEGVGTEPEKGDGPENGDEVNMVNEPFVDEVVIKDVDPDIGAGHEQGLGQQASEDEITVLHDNSEGESGESSAFVLDEGWGEDEGEGEDEGECEGEGEGEDEGEGEGEDEDECEGQGEGEDSNLHFDVDVDMSEFMSVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G519380`
TK1151 ID	TkA02G519380
OH-1004 ID	LXL04_015060
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	60.200
Protein coverage (%)	TK1151 90.382 / OH-1004 99.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G519380`
Location	Chr02:133852456-133857481 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015060` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G52520 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · TkA02G519380 · TK1151

Cytoplasm0.141

Rank 2 · TkA02G519380 · TK1151

Cell membrane0.022

Rank 3 · TkA02G519380 · TK1151

Mitochondrion0.020

Rank 4 · TkA02G519380 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA02G519380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03108DBD_Tnp_Mut327-368 aa

PF08731AFT332-425 aa

PF03108DBD_Tnp_Mut398-415 aa

PF10551MULE567-593 aa

PF00872Transposase_mut568-651 aa

PF03108DBD_Tnp_Mut679-708 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G519380	`PF03108`	DBD_Tnp_Mut	327	368	1.1e-05	25.6
TkA02G519380	`PF08731`	AFT	332	425	0.0016	19.5
TkA02G519380	`PF03108`	DBD_Tnp_Mut	398	415	1.1e-05	25.6
TkA02G519380	`PF10551`	MULE	567	593	0.0077	17.3
TkA02G519380	`PF00872`	Transposase_mut	568	651	0.021	14.5
TkA02G519380	`PF03108`	DBD_Tnp_Mut	679	708	1.1e-05	25.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card