Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3578 bp · TkA02G516370|TK1151|cDNA
AAAGAAACCATTTAATGCACAGAGTTGTACGCCAGAAGTTGCAAACATCTTGCTGACGGCCTCTCCGAATTTTTACTCGGTCCACCTGCTCCCTCTCCTTCTCTCTCTAGATCACACTATATTCCTCGGTCGCTTATGTATGAATCTATAGTTTGATTCCACATTGACTGCATTTTCTGATTGGAATTGGATTCTCGGATCGCGATAATCTAGAGAAGCAGACGCCTCTCGGCTGGATCTGATCCGAGTCTAGCGGAGAT...
2970 bp · TkA02G516370|TK1151|CDS
ATGGCGTTGTCAGGTATGAGAGGTCTTTCCGTCTTCATATCCGAAATCCGTAATTGCCAAAACAAAGAACAAGAACGCCTTCGTGTTGATAAAGAACTCGGCAATATCCGTACTCGCTTCAAAAACGAAAAGGGTCTGACACCATATGACAAGAAGAAATACGTTTGGAAAATGCTTTACATATTTATGCTAGGATACGATGTAGACTTTGGTCATATGGAAGCTGTTTCTTTAATTTCTGCACCAAAATATCCAGAAAA...
Protein
Download Protein FASTA989 aa · TkA02G516370|TK1151|PROTEIN
MALSGMRGLSVFISEIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYDKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYLVTSCLLNENHDFLRLAINTVRNDIIGRNETFQCLALTLVGNIGGREFAESLAPDVQKLLISSSCRPLVRKKAALCLLRLFRKNSDVVNVDGWSDRMTQLLDERNLGVLTSSMSLFVSLVSNNHEAYWSCLPKCVKILERLARNQDIPQEYTYYGIPSPWLQVKTMRAL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G516370 |
|---|---|
| TK1151 ID | TkA02G516370 |
| OH-1004 ID | LXL04_004618 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 84.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G516370 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:133045749-133051754 (-) | |||||||||
| Description | Similar to ALPHAC-AD: AP-2 complex subunit alpha-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0048268 clathrin coat assembly Biological Process GO:0072583 clathrin-dependent endocytosis Biological Process GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component GO:0009898 cytoplasmic side of plasma membrane Cellular Component GO:0030117 membrane coat Cellular Component GO:0030122 AP-2 adaptor complex Cellular Component GO:0030141 secretory granule Cellular Component GO:0031410 cytoplasmic vesicle Cellular Component GO:0008289 lipid binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G22770 ath:AT5G22780 bta:515216 mmu:11772 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01602Adaptin_N28-582 aaPF12717Cnd1125-265 aaPF13646HEAT_2125-171 aaPF02985HEAT155-172 aaPF13646HEAT_2267-282 aaPF02985HEAT267-282 aaPF12717Cnd1344-385 aaPF02985HEAT365-390 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G516370 | PF01602 | Adaptin_N | 28 | 582 | 4.7e-114 | 382.5 |
| TkA02G516370 | PF12717 | Cnd1 | 125 | 265 | 9.6e-10 | 39.5 |
| TkA02G516370 | PF13646 | HEAT_2 | 125 | 171 | 0.00075 | 20.5 |
| TkA02G516370 | PF02985 | HEAT | 155 | 172 | 0.0035 | 18.2 |
| TkA02G516370 | PF13646 | HEAT_2 | 267 | 282 | 0.00075 | 20.5 |
| TkA02G516370 | PF02985 | HEAT | 267 | 282 | 0.0035 | 18.2 |
| TkA02G516370 | PF12717 | Cnd1 | 344 | 385 | 9.6e-10 | 39.5 |
| TkA02G516370 | PF02985 | HEAT | 365 | 390 | 0.0035 | 18.2 |
| TkA02G516370 | PF13646 | HEAT_2 | 366 | 417 | 0.00075 | 20.5 |
| TkA02G516370 | PF05327 | RRN3 | 432 | 591 | 0.048 | 12.9 |
| TkA02G516370 | PF02883 | Alpha_adaptinC2 | 646 | 669 | 9.3e-12 | 45.9 |
| TkA02G516370 | PF02883 | Alpha_adaptinC2 | 732 | 829 | 9.3e-12 | 45.9 |
| TkA02G516370 | PF02296 | Alpha_adaptin_C | 839 | 955 | 4.2e-17 | 63.1 |
| TkA02G516370 | PF02883 | Alpha_adaptinC2 | 956 | 975 | 9.3e-12 | 45.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.