TkA02G508720 | RubberDandelionOmics

Gene overview

TkA02G508720

Reference: TK1151 Chr: Chr02 Coordinates: 130559897-130560731 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA02G508720|TK1151|cDNA

TTTGAATATTTCAGAAGTTGGCTTGTTGATGGTAGAACAATAGCAAAGAAAGTAAAAACTTCCAGTCTTCCATTAATCCATCAAATCAAAGACTGTGGAGCAAACAGGGAATGCCCAAAATGCCATCACAAGATTGACAACAGTGATGTATCAATTGAATGGCCAGGGTTACCAATCGGTGTTAAATTTGAACCCACTGATGTAGAGCTTCTAGAACACCTGGCAGCCAAATGTGAAACAGGAAACAAAAAACCACACCA...

CDS

Download CDS FASTA

564 bp · TkA02G508720|TK1151|CDS

TTTGAATATTTCAGAAGTTGGCTTGTTGATGGTAGAACAATAGCAAAGAAAGTAAAAACTTCCAGTCTTCCATTAATCCATCAAATCAAAGACTGTGGAGCAAACAGGGAATGCCCAAAATGCCATCACAAGATTGACAACAGTGATGTATCAATTGAATGGCCAGGGTTACCAATCGGTGTTAAATTTGAACCCACTGATGTAGAGCTTCTAGAACACCTGGCAGCCAAATGTGAAACAGGAAACAAAAAACCACACCA...

Protein

Download Protein FASTA

187 aa · TkA02G508720|TK1151|PROTEIN

FEYFRSWLVDGRTIAKKVKTSSLPLIHQIKDCGANRECPKCHHKIDNSDVSIEWPGLPIGVKFEPTDVELLEHLAAKCETGNKKPHQFIDEFIPTIDVEEGICSKHPENLPGARKDGNCVHFFYRNTNAYTTFQRSVAKSAKSQVSRKMSVGIKQEVLKMKKKGSMLFQRYFISHRKREGMMMWMCG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G508720`
TK1151 ID	TkA02G508720
OH-1004 ID	LXL04_023912
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	68.700
Protein coverage (%)	TK1151 71.658 / OH-1004 37.535 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G508720

Location Chr02:130559897-130560731 (+)

Description Similar to SOG1: SUPPRESSOR OF GAMMA RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25580`	Transcription factor regulating the transcriptional activation response to gamma irradiation.	Suppressor of gamma response 1 (SOG1) encodes a putative transcription factor governing multiple responses to DNA damage.2009 · DOI: 10.1073/pnas.0810304106 A shared DNA-damage-response pathway for induction of stem-cell death by UVB and by gamma irradiation.2010 · DOI: 10.1016/j.dnarep.2010.06.006 Arabidopsis casein kinase 2 triggers stem cell exhaustion under Al toxicity and phosphate deficiency through activating the DNA damage response pathway.2021 · DOI: 10.1093/plcell/koab005
`At4g29230`	Transcription activator involved in xylem formation.	No verified direct reference in this release
`At4g28500`	Transcriptional activator that plays a regulatory role in the development of secondary cell wall fibers.	A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061325 SND2, a NAC transcription factor gene, regulates genes involved in secondary cell wall development in Arabidopsis fibres and increases fibre cell area in Eucalyptus.2011 · DOI: 10.1186/1471-2229-11-173
`At1g28470`	Transcriptional activator that plays a regulatory role in the development of secondary cell wall fibers.	A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061325

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023912 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010321 regulation of vegetative phase change Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0040020 regulation of meiotic nuclear division Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071555 cell wall organization Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:2000652 regulation of secondary cell wall biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G25580

ath:AT1G28470

ath:AT1G33060

ath:AT4G28500

ath:AT4G29230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · TkA02G508720 · TK1151

Cytoplasm0.181

Rank 2 · TkA02G508720 · TK1151

Cell membrane0.047

Rank 3 · TkA02G508720 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA02G508720 · TK1151

Mitochondrion0.025

Rank 5 · TkA02G508720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26788DUF826028-48 aa

PF02365NAM58-169 aa

PF09183DUF194761-96 aa

PF09183DUF1947138-164 aa

PF26788DUF8260155-180 aa

PF09183DUF1947169-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G508720	`PF26788`	DUF8260	28	48	0.034	14.9
TkA02G508720	`PF02365`	NAM	58	169	8.5e-11	43.1
TkA02G508720	`PF09183`	DUF1947	61	96	0.68	10.8
TkA02G508720	`PF09183`	DUF1947	138	164	0.68	10.8
TkA02G508720	`PF26788`	DUF8260	155	180	0.034	14.9
TkA02G508720	`PF09183`	DUF1947	169	178	0.68	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQK2`	Arabidopsis thaliana	sp\|Q6NQK2\|NAC8_ARATH SUPPRESSOR OF GAMMA RESPONSE 1	48.100%	Swiss-Prot	Medium
`Q9M0F8`	Arabidopsis thaliana	sp\|Q9M0F8\|NAC75_ARATH NAC domain-containing protein 75	53.200%	Swiss-Prot	Medium
`O49459`	Arabidopsis thaliana	sp\|O49459\|NAC73_ARATH NAC domain-containing protein 73	53.400%	Swiss-Prot	Medium
`F4HY61`	Arabidopsis thaliana	sp\|F4HY61\|NAC10_ARATH NAC domain-containing protein 10	52.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card