TkA02G503740 | RubberDandelionOmics

Gene overview

TkA02G503740

Reference: TK1151 Chr: Chr02 Coordinates: 129207587-129209329 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1299 bp · TkA02G503740|TK1151|cDNA

TTATGATTTCCTTAAAAGATGTTTATCGTATTGTGGCAGCCATAATTCCATTATATGTCGCCATGATCTTGGCTTACGTGTCTGTAAAATGGTTGAAGCTTTTTACCCAAGACCAATGTGCGGGTATAAACAAATTTGTTGCTAAATTTTCAATTCCTTTGTTATCTTTTCAAGTGATATCCAAAAGTAATCCCTACAAGATGAACCTCAAGCTAATTGGTGCTGATGTTCTTCAAAAAGTCATTGCCTTGATTATGGTT...

CDS

Download CDS FASTA

1077 bp · TkA02G503740|TK1151|CDS

ATGATTTCCTTAAAAGATGTTTATCGTATTGTGGCAGCCATAATTCCATTATATGTCGCCATGATCTTGGCTTACGTGTCTGTAAAATGGTTGAAGCTTTTTACCCAAGACCAATGTGCGGGTATAAACAAATTTGTTGCTAAATTTTCAATTCCTTTGTTATCTTTTCAAGTGATATCCAAAAGTAATCCCTACAAGATGAACCTCAAGCTAATTGGTGCTGATGTTCTTCAAAAAGTCATTGCCTTGATTATGGTTGC...

Protein

Download Protein FASTA

358 aa · TkA02G503740|TK1151|PROTEIN

MISLKDVYRIVAAIIPLYVAMILAYVSVKWLKLFTQDQCAGINKFVAKFSIPLLSFQVISKSNPYKMNLKLIGADVLQKVIALIMVAIFTKVRSNGQLNWIITGISLSTLPNTLILGIPLLKAIYGDEAHVLLAQIVALQSVIWYNLLLFLFELSNASEDHIIQSSEATTTIGNPEVREEAEEKEGTKSRNPGRRRKIIMILLTVGKKLLMNPNFHATVAGLAWASISFGCNVKLPKVVEDSITILSDGGLGMAMFSLGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G503740`
TK1151 ID	TkA02G503740
OH-1004 ID	LXL04_013342
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G503740

Location Chr02:129207587-129209329 (+)

Description Similar to PIN8: Auxin efflux carrier component 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15100`	Acts as a component of the auxin efflux carrier.	No verified direct reference in this release
`At5g16530`	Auxin transporter regulating intracellular auxin homeostasis and metabolism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0715600`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os11g0137000`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os12g0133800`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013342 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0080162 endoplasmic reticulum to cytosol auxin transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0071944 cell periphery Cellular Component

GO:0010329 auxin efflux transmembrane transporter activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G15100

ath:AT5G16530

dosa:Os01g0715600

dosa:Os01g0919800

dosa:Os08g0529000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.754

Rank 1 · TkA02G503740 · TK1151

Endoplasmic reticulum0.122

Rank 2 · TkA02G503740 · TK1151

Lysosome / Vacuole0.066

Rank 3 · TkA02G503740 · TK1151

Cytoplasm0.059

Rank 4 · TkA02G503740 · TK1151

Golgi apparatus0.033

Rank 5 · TkA02G503740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10541KASH8-52 aa

PF03547Mem_trans10-353 aa

PF10541KASH147-151 aa

PF10541KASH275-284 aa

PF10541KASH344-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G503740	`PF10541`	KASH	8	52	1.3	10.1
TkA02G503740	`PF03547`	Mem_trans	10	353	4.3e-87	292.6
TkA02G503740	`PF10541`	KASH	147	151	1.3	10.1
TkA02G503740	`PF10541`	KASH	275	284	1.3	10.1
TkA02G503740	`PF10541`	KASH	344	357	1.3	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFP6`	Arabidopsis thaliana	sp\|Q9LFP6\|PIN8_ARATH Auxin efflux carrier component 8	53.100%	Swiss-Prot	High
`Q9FFD0`	Arabidopsis thaliana	sp\|Q9FFD0\|PIN5_ARATH Auxin efflux carrier component 5	42.300%	Swiss-Prot	Medium
`Q0JJV0`	Oryza sativa subsp. japonica	sp\|Q0JJV0\|PIN8_ORYSJ Probable auxin efflux carrier component 8	53.800%	Swiss-Prot	High
`P0C0X5`	Oryza sativa subsp. japonica	sp\|P0C0X5\|PIN1B_ORYSJ Probable auxin efflux carrier component 1b	35.700%	Swiss-Prot	Medium
`Q0IQA5`	Oryza sativa subsp. japonica	sp\|Q0IQA5\|PIN1D_ORYSJ Probable auxin efflux carrier component 1d	35.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card