TkA02G503690 | RubberDandelionOmics

Gene overview

TkA02G503690

Reference: TK1151 Chr: Chr02 Coordinates: 129180568-129182885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1489 bp · TkA02G503690|TK1151|cDNA

CAGACAACCATCCAAAACCTGATTGGCTCAGCATGTGTTCTTGGAGGGTGAAGAAGAAGCACGAGTACGAGAAACACAACAATGGCGTTAATTGCAGTGAAAAATGAAGAGAATTCTTTACGGCGAAGTATTGATATGGTTGAAAATGACGTTCCTGCCCTTGAGCCAAGACGTGTGAAGAGAAGAAGAAGAGATCTGACGTTAGATTGTAAAACTCAACAGTTGCAAACGGCACAACAAACGGATCAACCTTCACCTTC...

CDS

Download CDS FASTA

1170 bp · TkA02G503690|TK1151|CDS

ATGGCGTTAATTGCAGTGAAAAATGAAGAGAATTCTTTACGGCGAAGTATTGATATGGTTGAAAATGACGTTCCTGCCCTTGAGCCAAGACGTGTGAAGAGAAGAAGAAGAGATCTGACGTTAGATTGTAAAACTCAACAGTTGCAAACGGCACAACAAACGGATCAACCTTCACCTTCACCGACTACTACTACTGTGAAAAGAAGTTCTAAGTTTCGGGGTGTGAGTAAACATAGGTGGACAGGTAGATATGAAGCACA...

Protein

Download Protein FASTA

389 aa · TkA02G503690|TK1151|PROTEIN

MALIAVKNEENSLRRSIDMVENDVPALEPRRVKRRRRDLTLDCKTQQLQTAQQTDQPSPSPTTTTVKRSSKFRGVSKHRWTGRYEAHLWDKLSWNVTQKKKGKQDYDSGAYDEEESAARAYDLAALKYWGSSTFTNFPVSDYEKEITIMQTVTKEEYLASLRRKSSGFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYLYLGTYSTQEEAARAYDIAAIEYRGVNAVTNFDLSTYIRWLKPGAQTPAANQESQKHKEIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G503690`
TK1151 ID	TkA02G503690
OH-1004 ID	LXL04_013344
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 97.686 / OH-1004 80.687 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G503690

Location Chr02:129180568-129182885 (-)

Description Similar to WRI1: Ethylene-responsive transcription factor WRI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54320`	May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).	Contrapuntal networks of gene expression during Arabidopsis seed filling.2002 · DOI: 10.1105/tpc.000877 WRINKLED1 encodes an AP2/EREB domain protein involved in the control of storage compound biosynthesis in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02235.x ACTIVATOR of Spomin::LUC1/WRINKLED1 of Arabidopsis thaliana transactivates sugar-inducible promoters.2005 · DOI: 10.1093/pcp/pci072 A spatiotemporal analysis of enzymatic activities associated with carbon metabolism in wild-type and mutant embryos of Arabidopsis using in situ histochemistry.2006 · DOI: 10.1111/j.1365-313x.2006.02682.x WRI1 is required for seed germination and seedling establishment.2006 · DOI: 10.1104/pp.106.079574 wrinkled1: A novel, low-seed-oil mutant of Arabidopsis with a deficiency in the seed-specific regulation of carbohydrate metabolism.1998 · DOI: 10.1104/pp.118.1.91
`At1g16060`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g79700`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g57390`	Probably acts as a transcriptional activator.	AINTEGUMENTA-like (AIL) genes are expressed in young tissues and may specify meristematic or division-competent states.2005 · DOI: 10.1007/s11103-005-0955-6
`At5g65510`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013344 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009845 seed germination Biological Process

KEGG gene cross-reference

ath:AT1G16060

ath:AT3G54320

ath:AT5G57390

bna:106385624

dosa:Os07g0124700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA02G503690 · TK1151

Cytoplasm0.083

Rank 2 · TkA02G503690 · TK1151

Cell membrane0.026

Rank 3 · TkA02G503690 · TK1151

Plastid0.018

Rank 4 · TkA02G503690 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA02G503690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP270-131 aa

PF00847AP2173-224 aa

PF28076CBU_0585_lpg0581247-260 aa

PF28076CBU_0585_lpg0581284-298 aa

PF28076CBU_0585_lpg0581345-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G503690	`PF00847`	AP2	70	131	3.6e-21	75.9
TkA02G503690	`PF00847`	AP2	173	224	3.6e-21	75.9
TkA02G503690	`PF28076`	CBU_0585_lpg0581	247	260	1.0	10.0
TkA02G503690	`PF28076`	CBU_0585_lpg0581	284	298	1.0	10.0
TkA02G503690	`PF28076`	CBU_0585_lpg0581	345	366	1.0	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6X5Y6`	Arabidopsis thaliana	sp\|Q6X5Y6\|WRI1_ARATH Ethylene-responsive transcription factor WRI1	71.400%	Swiss-Prot	Medium
`Q94AN4`	Arabidopsis thaliana	sp\|Q94AN4\|AP2L1_ARATH AP2-like ethylene-responsive transcription factor At1g16060	74.300%	Swiss-Prot	Low
`A0JPZ8`	Arabidopsis thaliana	sp\|A0JPZ8\|AP2L3_ARATH AP2-like ethylene-responsive transcription factor At1g79700	67.700%	Swiss-Prot	Low
`Q6PQQ3`	Arabidopsis thaliana	sp\|Q6PQQ3\|AIL5_ARATH AP2-like ethylene-responsive transcription factor AIL5	68.600%	Swiss-Prot	Low
`Q6J9N8`	Arabidopsis thaliana	sp\|Q6J9N8\|AIL7_ARATH AP2-like ethylene-responsive transcription factor AIL7	61.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card