TkA02G502500 | RubberDandelionOmics

Gene overview

TkA02G502500

Reference: TK1151 Chr: Chr02 Coordinates: 128802267-128802807 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA02G502500|TK1151|cDNA

ATGGATGTCAAATCCGGTGAGAAGTTGCTCAGTGTTTCCAAAATCGACGACCTGAAAACGAAGTTGTTGGGCGAGTTTCCGGAATGGGTGAACCCTGGTGTTCGGAGGTTGCTTCAAGCGGGTCGGCCGACGCCGAATGTGACGGTGGCTCTGGACGGAACCGAAGATGTAAAAACCATTAAAGAGGCAATGGGAATGGTACCAAAGAAAAGCAAGACGATATTCATAATATACATCAAGGAAGGTGTGTATATGGAGAA...

CDS

Download CDS FASTA

357 bp · TkA02G502500|TK1151|CDS

ATGGATGTCAAATCCGGTGAGAAGTTGCTCAGTGTTTCCAAAATCGACGACCTGAAAACGAAGTTGTTGGGCGAGTTTCCGGAATGGGTGAACCCTGGTGTTCGGAGGTTGCTTCAAGCGGGTCGGCCGACGCCGAATGTGACGGTGGCTCTGGACGGAACCGAAGATGTAAAAACCATTAAAGAGGCAATGGGAATGGTACCAAAGAAAAGCAAGACGATATTCATAATATACATCAAGGAAGGTGTGTATATGGAGAA...

Protein

Download Protein FASTA

118 aa · TkA02G502500|TK1151|PROTEIN

MDVKSGEKLLSVSKIDDLKTKLLGEFPEWVNPGVRRLLQAGRPTPNVTVALDGTEDVKTIKEAMGMVPKKSKTIFIIYIKEGVYMENVVLDKSFWNVMIYGDGKDKYIVSANSKIKTM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G502500`
TK1151 ID	TkA02G502500
OH-1004 ID	LXL04_005868
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 98.305 / OH-1004 73.885 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G502500

Location Chr02:128802267-128802807 (-)

Description Similar to PME26: Putative pectinesterase/pectinesterase inhibitor 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14300`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At1g53840`	Acts in the modification of cell walls via demethylesterification of cell wall pectin (By similarity).	Methylation of protein phosphatase 2A-Influence of regulators and environmental stress factors.2017 · DOI: 10.1111/pce.13038
`At4g33220`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005868 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G53840

ath:AT3G05610

ath:AT3G14300

sly:544016

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.719

Rank 1 · TkA02G502500 · TK1151

Cytoplasm0.082

Rank 2 · TkA02G502500 · TK1151

Endoplasmic reticulum0.074

Rank 3 · TkA02G502500 · TK1151

Lysosome / Vacuole0.061

Rank 4 · TkA02G502500 · TK1151

Cell membrane0.031

Rank 5 · TkA02G502500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01095Pectinesterase46-114 aa

PF17659RADX61-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G502500	`PF01095`	Pectinesterase	46	114	1.1e-19	71.0
TkA02G502500	`PF17659`	RADX	61	100	0.12	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUL8`	Arabidopsis thaliana	sp\|Q9LUL8\|PME26_ARATH Putative pectinesterase/pectinesterase inhibitor 26	60.000%	Swiss-Prot	High
`Q43867`	Arabidopsis thaliana	sp\|Q43867\|PME1_ARATH Pectinesterase 1	58.000%	Swiss-Prot	High
`Q9SMY7`	Arabidopsis thaliana	sp\|Q9SMY7\|PME44_ARATH Probable pectinesterase/pectinesterase inhibitor 44	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card