RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G501990
Reference: TK1151 Chr: Chr02 Coordinates: 128648086-128656786 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4722 bp · TkA02G501990|TK1151|cDNA

TTCGGATCCGGGTAGTTCATCTGTACCGGAAACAGTGCCCATACAGTAGCGTTGGAGTTCGATTTGAACGAAACCCCACTCCCTTCTTCCGGAGAAGAAGCTGCGGGTGGTAATGGCGACGGGTCTACGGCGGATCACCGGTGTTGCTCATGTTGTGAGGCGAAAGGGAAGGTGGTGGTATGCTGTGAGTGTGCAAAACATTTTCAAGTAGAGTGTTTTAGGGGGAGACTAGGAGGGAGGGAGAGGACGTGTCCGAGTGT...

CDS

Download CDS FASTA

873 bp · TkA02G501990|TK1151|CDS

ATGCTACCAAACTTTCATATGTCAATGCTGAAGGTGTTAGTGGAAGACATGCTGGCAAAAGTAACAATATATGATCCTCCATTTGGTTCCATGGAATCCAAGTCAAGAAAAGGGAGTAGGAAGAAATTAAACATGGACATTAGTAACATCACGGTTTCTAGCAAAAAGGGTAGTTCTGGTATTTTTCCTATTAATGCAATTACATGGCCAGAGGTAGCCAGGAGATACATTTTGGTTCTGCTATCCATGGATGATAATTA...

Protein

Download Protein FASTA

290 aa · TkA02G501990|TK1151|PROTEIN

MLPNFHMSMLKVLVEDMLAKVTIYDPPFGSMESKSRKGSRKKLNMDISNITVSSKKGSSGIFPINAITWPEVARRYILVLLSMDDNYEAPDLTNREFDQVFHCLNGDGGPLCGSLTGMAAIEADAMILAEASKRIFSCVKSSNIGDLIIDNKDVDMNECVREKKVIIDNKCPEWIKVLEPIRRQPTNVGARIRNRVFKSLEKDPPEWAKEMLLRSISKDVYKGNASGPTRKIVVSVLDKVRDETPLTKKKVKESRVVRTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G501990
TK1151 IDTkA02G501990
OH-1004 IDLXL04_011568
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)95.300
Protein coverage (%)TK1151 98.966 / OH-1004 16.835
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G501990
LocationChr02:128648086-128656786 (+)
DescriptionSimilar to MBD9: Methyl-CpG-binding domain-containing protein 9
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g01460 Probable transcriptional regulator that acts as a histone acetyltransferase.
AtMBD9: a protein with a methyl-CpG-binding domain regulates flowering time and shoot branching in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2006.02691.x
AtMBD9 modulates Arabidopsis development through the dual epigenetic pathways of DNA methylation and histone acetylation.2009 · DOI: 10.1111/j.1365-313x.2009.03860.x

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011568 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006366 transcription by RNA polymerase II Biological Process
GO:0006397 mRNA processing Biological Process
GO:0010223 secondary shoot formation Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0040029 epigenetic regulation of gene expression Biological Process
GO:0048573 photoperiodism, flowering Biological Process
GO:0000812 Swr1 complex Cellular Component
GO:0005634 nucleus Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0016020 membrane Cellular Component
KEGG gene cross-reference
ath:AT3G01460
hsa:57661
mmu:101471
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.397
Rank 1 · TkA02G501990 · TK1151
Nucleus0.360
Rank 2 · TkA02G501990 · TK1151
Mitochondrion0.145
Rank 3 · TkA02G501990 · TK1151
Cell membrane0.101
Rank 4 · TkA02G501990 · TK1151
Endoplasmic reticulum0.056
Rank 5 · TkA02G501990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SGH2Arabidopsis thalianasp|Q9SGH2|MBD9_ARATH Methyl-CpG-binding domain-containing protein 947.300%Swiss-ProtMedium

JBrowse

View in Genome Browser