TkA02G498570 | RubberDandelionOmics

Gene overview

TkA02G498570

Reference: TK1151 Chr: Chr02 Coordinates: 127729900-127736215 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · TkA02G498570|TK1151|cDNA

GGTTGTGGAAAATAGCCCCTTTTGTCATAAGTCAGATTTGTCCTTGTTGGAGACGAAAGGCGGAGGCGAAACCATTTTCTGGATCAACTCAAAACCTCCATCGTTGATCTCTCTCTCTCGCTCGCTCGCTCACAATTACTCCAAGCAAGTGACTAATCTCAATCCTCGGTGAAGGACTATTGACATGGCATCTAGGAGGAACATCAATTACTCTCGTCTTCCTGATGAAGACAATGACCATATAGGCAATGAAGGAAGAT...

CDS

Download CDS FASTA

351 bp · TkA02G498570|TK1151|CDS

ATGGCATCTAGGAGGAACATCAATTACTCTCGTCTTCCTGATGAAGACAATGACCATATAGGCAATGAAGGAAGATACGACCCTCGGTTTGACTACTCACCAACAAGCTTGGATGAAGTCCCATGGAAATCCATTGCCCTTGCACTTTTTCTACTGGTTCTTGGATGTGCACTTCTCCTTCTCTCCATCTTCATCTTCACAGGTCACATGGGAGGTGACAAATCCCAAGCATATGGCCTGTTAGGACTTGGTGCTCTCAC...

Protein

Download Protein FASTA

116 aa · TkA02G498570|TK1151|PROTEIN

MASRRNINYSRLPDEDNDHIGNEGRYDPRFDYSPTSLDEVPWKSIALALFLLVLGCALLLLSIFIFTGHMGGDKSQAYGLLGLGALTFLPGFYETRIAYYSWRGAQGFRFASIPGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G498570`
TK1151 ID	TkA02G498570
OH-1004 ID	LXL04_017984
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	47.300
Protein coverage (%)	TK1151 63.793 / OH-1004 70.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G498570`
Location	Chr02:127729900-127736215 (-)
Description	Similar to TMEM230: Transmembrane protein 230
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017984` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0048489 synaptic vesicle transport Biological Process GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0005776 autophagosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0012505 endomembrane system Cellular Component GO:0016020 membrane Cellular Component GO:0055037 recycling endosome Cellular Component
KEGG gene cross-reference	bta:515498 gga:419518 mmu:70612 pon:100172986 rno:681315 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385

Rank 1 · TkA02G498570 · TK1151

Golgi apparatus0.339

Rank 2 · TkA02G498570 · TK1151

Lysosome / Vacuole0.306

Rank 3 · TkA02G498570 · TK1151

Cell membrane0.170

Rank 4 · TkA02G498570 · TK1151

Endoplasmic reticulum0.157

Rank 5 · TkA02G498570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05915TMEM_230_13441-116 aa

PF28780DUF846043-64 aa

PF13567DUF413145-93 aa

PF28780DUF846079-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G498570	`PF05915`	TMEM_230_134	41	116	4.7e-24	85.5
TkA02G498570	`PF28780`	DUF8460	43	64	0.12	13.8
TkA02G498570	`PF13567`	DUF4131	45	93	0.77	10.2
TkA02G498570	`PF28780`	DUF8460	79	92	0.12	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card