TkA02G494080 | RubberDandelionOmics

Gene overview

TkA02G494080

Reference: TK1151 Chr: Chr02 Coordinates: 126474698-126477051 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · TkA02G494080|TK1151|cDNA

ATTTCACAATCCTAGCCACCGTAAACTTGGAATGGTTGATCACTTCAAAGGATCAAGCTTCTGTTCAGGGATATAGTGCACTTGACAGGATTTAAGTGACCCACCGGAAATGGATGTGTGTCGTATTCCGGCGGTACGATTTCCCGCGGGTCCTCTCAGGCACCCAGTCGATCCCGTCTCGAAAAACCTGTCAATCGGAAGACCTTCAAGTGTCCGATTTTGTTCTTCAGCATCTGCAGAATTGCGTCACTTCTGTAATG...

CDS

Download CDS FASTA

591 bp · TkA02G494080|TK1151|CDS

ATGGATGTGTGTCGTATTCCGGCGGTACGATTTCCCGCGGGTCCTCTCAGGCACCCAGTCGATCCCGTCTCGAAAAACCTGTCAATCGGAAGACCTTCAAGTGTCCGATTTTGTTCTTCAGCATCTGCAGAATTGCGTCACTTCTGTAATGGAAATAATCACGGAACTCAGAATCGGATTTTTATACTCGGCATGGGTTTCGTCGGCCAGTTTGTTGCTCAAGACCTAATGAATCAAGGATGGGCTGTATCTGGAACATG...

Protein

Download Protein FASTA

196 aa · TkA02G494080|TK1151|PROTEIN

MDVCRIPAVRFPAGPLRHPVDPVSKNLSIGRPSSVRFCSSASAELRHFCNGNNHGTQNRIFILGMGFVGQFVAQDLMNQGWAVSGTCTSDSKKEMLEKLGFNVHLFDATDPKLEVINILNEHTHLLVSIPPCKDIGDPVLQHAKLLKKKLNNKHLQWLCYLSTTSVYGDCGGEWVDESKFILHHFQTLIVSITVIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G494080`
TK1151 ID	TkA02G494080
OH-1004 ID	LXL04_013479
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.200
Protein coverage (%)	TK1151 90.816 / OH-1004 52.011 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G494080`
Location	Chr02:126474698-126477051 (+)
Description	Similar to yeeZ: Protein YeeZ (Escherichia coli (strain K12)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013479` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004029 aldehyde dehydrogenase (NAD+) activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ece:Z3178 ecj:JW1998 eco:b2016 ecoc:C3026_11370 ecs:ECs_2818 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · TkA02G494080 · TK1151

Mitochondrion0.043

Rank 2 · TkA02G494080 · TK1151

Nucleus0.024

Rank 3 · TkA02G494080 · TK1151

Cytoplasm0.024

Rank 4 · TkA02G494080 · TK1151

Peroxisome0.014

Rank 5 · TkA02G494080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF028262-Hacid_dh_C57-108 aa

PF01370Epimerase60-121 aa

PF02254TrkA_N60-112 aa

PF03435Sacchrp_dh_NADP60-128 aa

PF02558ApbA60-119 aa

PF03446NAD_binding_260-101 aa

PF16363GDP_Man_Dehyd64-104 aa

PF00107ADH_zinc_N68-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G494080	`PF02826`	2-Hacid_dh_C	57	108	0.19	11.8
TkA02G494080	`PF01370`	Epimerase	60	121	0.0036	17.5
TkA02G494080	`PF02254`	TrkA_N	60	112	0.018	16.1
TkA02G494080	`PF03435`	Sacchrp_dh_NADP	60	128	0.021	15.9
TkA02G494080	`PF02558`	ApbA	60	119	0.055	13.8
TkA02G494080	`PF03446`	NAD_binding_2	60	101	0.31	11.8
TkA02G494080	`PF16363`	GDP_Man_Dehyd	64	104	0.11	12.7
TkA02G494080	`PF00107`	ADH_zinc_N	68	108	0.17	12.6
TkA02G494080	`PF01370`	Epimerase	155	172	0.0036	17.5
TkA02G494080	`PF16342`	DUF4972	155	183	0.38	11.5
TkA02G494080	`PF16363`	GDP_Man_Dehyd	159	177	0.11	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card