TkA02G493810 | RubberDandelionOmics

Gene overview

TkA02G493810

Reference: TK1151 Chr: Chr02 Coordinates: 126253334-126255106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1453 bp · TkA02G493810|TK1151|cDNA

ACCAACCACACATTCATTTTTGCTACTACGATCTTCTACAAATATAAACCTCCACCTCTCAACTTCCATCATTCTCAGTTCGCCACCTTCAATGGCTTCTAAGGATCTTCATACTCTTATTCTAGCTTTATTTCTGCTCACTGCTTACACTATTGCTGCTACAGATGATAATGGAGGCGAGGCCTTGGGGGCTTCTTATATTTCGGCGATTCTTTGGTAGATGCCGGAAATAATAACTTTTTGCCAACATTATCTAAAGC...

CDS

Download CDS FASTA

759 bp · TkA02G493810|TK1151|CDS

ATGAACGGCACTGGGAGAATTTTTGTTAATCGACTATCAATGGACATCCAGATTGATTACTTTAACATCACGAGAAAACAAATCGATAAACTCCTCGGTGCATCAAAAGCAAAAGAACACATCATGAAGAAATCAATCTTCTCAATCACAATTGGATCCAACGACTTCCTTAATAATTATTTGCTTCCTGTTCTCTCGATTGGAGCTAGAGTGTCACAGACCCCTGATTCTTTTGTCGATGATCTTCTTAGTCACCTACG...

Protein

Download Protein FASTA

252 aa · TkA02G493810|TK1151|PROTEIN

MNGTGRIFVNRLSMDIQIDYFNITRKQIDKLLGASKAKEHIMKKSIFSITIGSNDFLNNYLLPVLSIGARVSQTPDSFVDDLLSHLRSQLTRLYQLDARKFILGNVGPIGCIPYQRTINQLNEDECVALPNQLALQYNAKLKDLVAELNDNLPGATFVHANVYDLVMELITNYAKYGFKTASKACCGNGGQYAGIIPCGPTSTLCTDRDKHVFWDPYHPSEAANILIAKQLLEGDPKYVSPMNLKELRDLGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G493810`
TK1151 ID	TkA02G493810
OH-1004 ID	LXL04_013494
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.206 / OH-1004 58.275 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G493810

Location Chr02:126253334-126255106 (-)

Description Similar to At2g23540: GDSL esterase/lipase At2g23540

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23540`	GDSL esterase/lipase At2g23540.	No verified direct reference in this release
`At3g50400`	GDSL esterase/lipase At3g50400.	No verified direct reference in this release
`At4g16230`	GDSL esterase/lipase At4g16230.	No verified direct reference in this release
`At5g41890`	GDSL esterase/lipase At5g41890.	No verified direct reference in this release
`At1g71691`	GDSL esterase/lipase At1g71691.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013494 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G23540

ath:AT3G50400

ath:AT4G16230

ath:AT5G15720

ath:AT5G41890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.797

Rank 1 · TkA02G493810 · TK1151

Cytoplasm0.071

Rank 2 · TkA02G493810 · TK1151

Lysosome / Vacuole0.050

Rank 3 · TkA02G493810 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA02G493810 · TK1151

Cell membrane0.028

Rank 5 · TkA02G493810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL4-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G493810	`PF00657`	Lipase_GDSL	4	231	8e-25	88.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80470`	Arabidopsis thaliana	sp\|O80470\|GDL38_ARATH GDSL esterase/lipase At2g23540	76.000%	Swiss-Prot	High
`Q9M2R9`	Arabidopsis thaliana	sp\|Q9M2R9\|GDL58_ARATH GDSL esterase/lipase At3g50400	66.100%	Swiss-Prot	High
`O23470`	Arabidopsis thaliana	sp\|O23470\|GDL64_ARATH GDSL esterase/lipase At4g16230	48.000%	Swiss-Prot	Medium
`Q9FJ25`	Arabidopsis thaliana	sp\|Q9FJ25\|GDL81_ARATH GDSL esterase/lipase At5g41890	39.200%	Swiss-Prot	Medium
`Q9SF78`	Arabidopsis thaliana	sp\|Q9SF78\|GDL29_ARATH GDSL esterase/lipase At1g71691	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card