TkA02G492130 | RubberDandelionOmics

Gene overview

TkA02G492130

Reference: TK1151 Chr: Chr02 Coordinates: 125811567-125814153 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

945 bp · TkA02G492130|TK1151|cDNA

ATGTCTCGCTCCTCCAGGCGGTTCTCCCCGTACAAAGACAACTCCGCCCCTCTTGAGGAACCCCCACTCGTGGCTCCCAAGAAGAATGGCGGGCTGGGAGTTGGTTGCCTGAAGACTCAAAATCATGCCTTACTGGCCAAATGGTGGTGGCGCCTCAAATCCGGGGAGAAATCCATTTGGAGCGGCGTGATTAGTAGTATCCACAACACCGCGAAACTTCCATGTTCTTCCATCACTAAGAAGACAGCTTCAGGGGCTTG...

CDS

Download CDS FASTA

945 bp · TkA02G492130|TK1151|CDS

ATGTCTCGCTCCTCCAGGCGGTTCTCCCCGTACAAAGACAACTCCGCCCCTCTTGAGGAACCCCCACTCGTGGCTCCCAAGAAGAATGGCGGGCTGGGAGTTGGTTGCCTGAAGACTCAAAATCATGCCTTACTGGCCAAATGGTGGTGGCGCCTCAAATCCGGGGAGAAATCCATTTGGAGCGGCGTGATTAGTAGTATCCACAACACCGCGAAACTTCCATGTTCTTCCATCACTAAGAAGACAGCTTCAGGGGCTTG...

Protein

Download Protein FASTA

314 aa · TkA02G492130|TK1151|PROTEIN

MSRSSRRFSPYKDNSAPLEEPPLVAPKKNGGLGVGCLKTQNHALLAKWWWRLKSGEKSIWSGVISSIHNTAKLPCSSITKKTASGAWSNIAKGITSLRKLNIAPSDIFSLQIGKDSEDKAWFNAAPDGQFSVENMRLFLQSKLNPYVGPKIVWIQEVPLKVRCLIWRIRLGKIAVADTPQHRGISIPNPNCPLCDHTTESVDHLFSHCSVSSSIRSWIIAWCGLPDLQFDSVNDFTDFAAVWGSCPRKRSILISIFYSFM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G492130`
TK1151 ID	TkA02G492130
OH-1004 ID	LXL04_004808
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	35.400
Protein coverage (%)	TK1151 88.217 / OH-1004 47.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G492130`
Location	Chr02:125811567-125814153 (+)
Description	Similar to HVA22J: HVA22-like protein j
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004808` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G19950 ath:AT1G75700 ath:AT2G36020 ath:AT5G42560 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · TkA02G492130 · TK1151

Nucleus0.312

Rank 2 · TkA02G492130 · TK1151

Cell membrane0.139

Rank 3 · TkA02G492130 · TK1151

Golgi apparatus0.064

Rank 4 · TkA02G492130 · TK1151

Lysosome / Vacuole0.056

Rank 5 · TkA02G492130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT131-213 aa

PF13966zf-RVT260-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G492130	`PF13966`	zf-RVT	131	213	5.4e-15	56.5
TkA02G492130	`PF13966`	zf-RVT	260	267	5.4e-15	56.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card