TkA02G482940 | RubberDandelionOmics

Gene overview

TkA02G482940

Reference: TK1151 Chr: Chr02 Coordinates: 123233104-123234099 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA02G482940|TK1151|cDNA

ATGGCAGCCTTAGGGTTTTCAACTTACGGTGCTTATAAGGTTTCTAGACATCCTTCTGTGATTAAGAAGAGGGACAGAGCAATTAAGGTTATAAGCGCCTTAGCTTCCATTACTGAGTTTCTCGGTGATTCCGCAGAGGCAGTCGGAGTGATTTCCAAGGATTTGAAAGAGTTCATACAATCCGATTCCGATCAAATCCCTACTAGTTTGAAGCAAGTTTTCAAAATCACGACGTCTGATGAATTCTCAGAGTCCATTGT...

CDS

Download CDS FASTA

963 bp · TkA02G482940|TK1151|CDS

ATGGCAGCCTTAGGGTTTTCAACTTACGGTGCTTATAAGGTTTCTAGACATCCTTCTGTGATTAAGAAGAGGGACAGAGCAATTAAGGTTATAAGCGCCTTAGCTTCCATTACTGAGTTTCTCGGTGATTCCGCAGAGGCAGTCGGAGTGATTTCCAAGGATTTGAAAGAGTTCATACAATCCGATTCCGATCAAATCCCTACTAGTTTGAAGCAAGTTTTCAAAATCACGACGTCTGATGAATTCTCAGAGTCCATTGT...

Protein

Download Protein FASTA

320 aa · TkA02G482940|TK1151|PROTEIN

MAALGFSTYGAYKVSRHPSVIKKRDRAIKVISALASITEFLGDSAEAVGVISKDLKEFIQSDSDQIPTSLKQVFKITTSDEFSESIVRVTRSFTVGLLRGYRIEAEKGDSGPSFSDRALDKLLTPAGSGFVSVIVGSFARNLVIESSKNSGTPLHEWLDTISDDTCKKIIGDCIQQFVTTMVTVYLDKTTDINTYDEILSGLTNPKHEEKARNLLALICNSAIETFVRTSHQVLTDRNGQELVLSKLKVGKRNNMRFVLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G482940`
TK1151 ID	TkA02G482940
OH-1004 ID	LXL04_013635
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 93.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G482940

Location Chr02:123233104-123234099 (-)

Description Similar to PP2A10: Protein PHLOEM PROTEIN 2-LIKE A10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10150`	Protein PHLOEM PROTEIN 2-LIKE A10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013635 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G10150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.569

Rank 1 · TkA02G482940 · TK1151

Peroxisome0.239

Rank 2 · TkA02G482940 · TK1151

Cytoplasm0.117

Rank 3 · TkA02G482940 · TK1151

Nucleus0.069

Rank 4 · TkA02G482940 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA02G482940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30836PP2-like5-240 aa

PF23289Spectrin_532-75 aa

PF27335TP_0481_C39-101 aa

PF27335TP_0481_C160-185 aa

PF23289Spectrin_5174-213 aa

PF30836PP2-like244-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G482940	`PF30836`	PP2-like	5	240	1.1e-113	380.7
TkA02G482940	`PF23289`	Spectrin_5	32	75	0.015	16.1
TkA02G482940	`PF27335`	TP_0481_C	39	101	0.075	13.7
TkA02G482940	`PF27335`	TP_0481_C	160	185	0.075	13.7
TkA02G482940	`PF23289`	Spectrin_5	174	213	0.015	16.1
TkA02G482940	`PF30836`	PP2-like	244	295	1.1e-113	380.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY57`	Arabidopsis thaliana	sp\|Q9SY57\|P2A10_ARATH Protein PHLOEM PROTEIN 2-LIKE A10	40.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card