TkA02G473910 | RubberDandelionOmics

Gene overview

TkA02G473910

Reference: TK1151 Chr: Chr02 Coordinates: 120955087-120958441 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2278 bp · TkA02G473910|TK1151|cDNA

CTGTTATTCAATATACAATATCAGCTCGTTCTATATAGCTCTCAAACTATAACTTTTGAAACTCAACTCTACTTCCCATTTAATTCCAACCATCAATATGATGTATCTCACAAAACAATTTCAACATCTGAAGATACAACTAGAAGTTATAAAATCTGCAACCAACAACTTTGCTGATGACAAATGCATCGGGAGAGGAGGATTCGGTAAAGTATACAAGGGAGAACTTCTCCGTTCTGAGGGGAATATAGTCGTTGCTA...

CDS

Download CDS FASTA

1446 bp · TkA02G473910|TK1151|CDS

ATGATGTATCTCACAAAACAATTTCAACATCTGAAGATACAACTAGAAGTTATAAAATCTGCAACCAACAACTTTGCTGATGACAAATGCATCGGGAGAGGAGGATTCGGTAAAGTATACAAGGGAGAACTTCTCCGTTCTGAGGGGAATATAGTCGTTGCTATAAAGCGATTGGATCCAAGATTTGGACAAGGAAACCCAGAATTTTGGAAGGAGATCGTTATACTTTCTCTTTACAAGCACAAAAATATTATTTCTCT...

Protein

Download Protein FASTA

481 aa · TkA02G473910|TK1151|PROTEIN

MMYLTKQFQHLKIQLEVIKSATNNFADDKCIGRGGFGKVYKGELLRSEGNIVVAIKRLDPRFGQGNPEFWKEIVILSLYKHKNIISLLGFCDESNEKILVYEYASRKSLDLYLNNANLSWIQRLKICIGVARGLAYLHNPGVSQQRVLHRDIKTSNILLDENWNPKISDLGLSKFGPANQQYTFCISNVVGTLGYCDPLYIETGLLTKESDVYSFGVVLFEVLCGRLCISNKNGTDESLTSLVRQYYQQNKISELIYGNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G473910`
TK1151 ID	TkA02G473910
OH-1004 ID	LXL04_013748
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.100
Protein coverage (%)	TK1151 98.960 / OH-1004 70.939 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G473910

Location Chr02:120955087-120958441 (-)

Description Similar to At1g30570: Probable receptor-like protein kinase At1g30570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G30570

ath:AT3G20530

ath:AT3G46290

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.461

Rank 1 · TkA02G473910 · TK1151

Cell membrane0.384

Rank 2 · TkA02G473910 · TK1151

Nucleus0.244

Rank 3 · TkA02G473910 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA02G473910 · TK1151

Golgi apparatus0.044

Rank 5 · TkA02G473910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18570Nup54_57_C6-19 aa

PF00069Pkinase27-295 aa

PF03109ABC127-60 aa

PF07714PK_Tyr_Ser-Thr29-297 aa

PF03109ABC194-184 aa

PF25368PUB10_N114-137 aa

PF25055DUF7792287-315 aa

PF19584MCAfunc309-437 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G473910	`PF18570`	Nup54_57_C	6	19	0.48	10.8
TkA02G473910	`PF00069`	Pkinase	27	295	5e-43	148.1
TkA02G473910	`PF03109`	ABC1	27	60	0.03	14.2
TkA02G473910	`PF07714`	PK_Tyr_Ser-Thr	29	297	3e-42	145.4
TkA02G473910	`PF03109`	ABC1	94	184	0.03	14.2
TkA02G473910	`PF25368`	PUB10_N	114	137	0.0024	19.2
TkA02G473910	`PF25055`	DUF7792	287	315	0.086	13.7
TkA02G473910	`PF19584`	MCAfunc	309	437	0.00013	22.3
TkA02G473910	`PF25368`	PUB10_N	314	397	0.0024	19.2
TkA02G473910	`PF25055`	DUF7792	352	400	0.086	13.7
TkA02G473910	`PF16274`	Qua1	419	461	0.23	12.2
TkA02G473910	`PF03109`	ABC1	436	473	0.03	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	47.100%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	45.100%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	44.400%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	45.500%	Swiss-Prot	Medium
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card