TkA02G473550 | RubberDandelionOmics

Gene overview

TkA02G473550

Reference: TK1151 Chr: Chr02 Coordinates: 120833836-120835523 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

859 bp · TkA02G473550|TK1151|cDNA

TGGCCTTATAAATTCACTTGCTCTCTCATTCACAATTGGCAGTACCCTCAACTCACGGCTATATTTGAACATAGTCCCCAAATTCAACTCAACTCATCTTACAAACCGAAGAAGACGATGGTAGAGGATTCCGTTGAGAATCAGGTGGCGGTCGGTGATGAATGTAATAGTATTGCTTTAGAACAGGAAACTTTGATTAATAGTAGCGGCGTTTCTTTTCATCGAACTGTTGGTGTGCTCCACATTGCTCTTAATCGCGT...

CDS

Download CDS FASTA

699 bp · TkA02G473550|TK1151|CDS

TGGCCTTATAAATTCACTTGCTCTCTCATTCACAATTGGCAGTACCCTCAACTCACGGCTATATTTGAACATAGTCCCCAAATTCAACTCAACTCATCTTACAAACCGAAGAAGACGATGGTAGAGGATTCCGTTGAGAATCAGGTGGCGGTCGGTGATGAATGTAATAGTATTGCTTTAGAACAGGAAACTTTGATTAATAGTAGCGGCGTTTCTTTTCATCGAACTGTTGGTGTGCTCCACATTGCTCTTAATCGCGT...

Protein

Download Protein FASTA

232 aa · TkA02G473550|TK1151|PROTEIN

WPYKFTCSLIHNWQYPQLTAIFEHSPQIQLNSSYKPKKTMVEDSVENQVAVGDECNSIALEQETLINSSGVSFHRTVGVLHIALNRVSKWFILVCYSGFILLRQDDNLAMWAVLGSILNVILSFTLKKIINQERPVSEVCCGPGMPSSHAQSISFATIFMILSIIGWLGLNGYSAILSGLIIAVGVYLSWLRVLLRYHTTSQVVVGAIVGSIFSIVWFCTCDTMVLNTLIHE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G473550`
TK1151 ID	TkA02G473550
OH-1004 ID	LXL04_024602
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	50.900
Protein coverage (%)	TK1151 84.052 / OH-1004 73.802 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G473550

Location Chr02:120833836-120835523 (+)

Description Similar to LPPE2: Lipid phosphate phosphatase epsilon 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66450`	Exhibits phosphatidate phosphatase (PAP) activity in vitro.	No verified direct reference in this release
`At3g50920`	Exhibits phosphatidate phosphatase (PAP) activity in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024602 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006651 diacylglycerol biosynthetic process Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0008195 phosphatidate phosphatase activity Molecular Function

GO:0042392 sphingosine-1-phosphate phosphatase activity Molecular Function

GO:0047874 dolichyldiphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT3G50920

ath:AT5G66450

sce:YGR036C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.523

Rank 1 · TkA02G473550 · TK1151

Golgi apparatus0.206

Rank 2 · TkA02G473550 · TK1151

Nucleus0.146

Rank 3 · TkA02G473550 · TK1151

Cytoplasm0.112

Rank 4 · TkA02G473550 · TK1151

Lysosome / Vacuole0.111

Rank 5 · TkA02G473550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01040UbiA89-127 aa

PF01569PAP2110-219 aa

PF02681DUF212110-167 aa

PF01040UbiA150-220 aa

PF02681DUF212198-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G473550	`PF01040`	UbiA	89	127	0.41	10.6
TkA02G473550	`PF01569`	PAP2	110	219	5e-08	33.5
TkA02G473550	`PF02681`	DUF212	110	167	0.0072	17.2
TkA02G473550	`PF01040`	UbiA	150	220	0.41	10.6
TkA02G473550	`PF02681`	DUF212	198	212	0.0072	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQL6`	Arabidopsis thaliana	sp\|Q6NQL6\|LPPE2_ARATH Lipid phosphate phosphatase epsilon 2, chloroplastic	49.700%	Swiss-Prot	Medium
`F4J220`	Arabidopsis thaliana	sp\|F4J220\|LPPE1_ARATH Lipid phosphate phosphatase epsilon 1, chloroplastic	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card