TkA02G473280 | RubberDandelionOmics

Gene overview

TkA02G473280

Reference: TK1151 Chr: Chr02 Coordinates: 120755897-120756703 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA02G473280|TK1151|cDNA

ATGGTGCAAAGAACAGTATTGAAGGTGCAACTATCAACCGATAAATGTAAGAAGAAGATCCTCAGATCGGTTTCTGGCCTCCAAGGCGTAGATAAGATTGAAATAGATGTCGCCAAAGGAACCGTAACTATAACGGGAGATGCGGATCCCTATGAGATTATTTCAAGAACAAAGAAGGCCGGAAAATTCGTGGAAGTGGTGACAGTTGGACCTCCTCCGGCACCTCCAAAGAAGCCGGAGGAAAAGAAACCCGAGGAGAA...

CDS

Download CDS FASTA

426 bp · TkA02G473280|TK1151|CDS

ATGGTGCAAAGAACAGTATTGAAGGTGCAACTATCAACCGATAAATGTAAGAAGAAGATCCTCAGATCGGTTTCTGGCCTCCAAGGCGTAGATAAGATTGAAATAGATGTCGCCAAAGGAACCGTAACTATAACGGGAGATGCGGATCCCTATGAGATTATTTCAAGAACAAAGAAGGCCGGAAAATTCGTGGAAGTGGTGACAGTTGGACCTCCTCCGGCACCTCCAAAGAAGCCGGAGGAAAAGAAACCCGAGGAGAA...

Protein

Download Protein FASTA

141 aa · TkA02G473280|TK1151|PROTEIN

MVQRTVLKVQLSTDKCKKKILRSVSGLQGVDKIEIDVAKGTVTITGDADPYEIISRTKKAGKFVEVVTVGPPPAPPKKPEEKKPEEKKPPEKKPEEKKPKEDVHQIHPYNNHMPQDCVVCRQITMEHMNRWEGQASTCSIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G473280`
TK1151 ID	TkA02G473280
OH-1004 ID	LXL04_013765
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G473280`
Location	Chr02:120755897-120756703 (-)
Description	Similar to HIPP39: Heavy metal-associated isoprenylated plant protein 39
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013765` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009507 chloroplast Cellular Component GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G01490 ath:AT3G05220 ath:AT3G06130 ath:AT3G56891 ath:AT5G19090 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.503

Rank 1 · TkA02G473280 · TK1151

Cytoplasm0.448

Rank 2 · TkA02G473280 · TK1151

Nucleus0.260

Rank 3 · TkA02G473280 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA02G473280 · TK1151

Mitochondrion0.035

Rank 5 · TkA02G473280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403HMA9-62 aa

PF04972BON13-49 aa

PF22768SPP1_Dit13-48 aa

PF10152CCDC5318-116 aa

PF00428Ribosomal_60s53-96 aa

PF22768SPP1_Dit119-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G473280	`PF00403`	HMA	9	62	2.2e-12	47.9
TkA02G473280	`PF04972`	BON	13	49	0.057	14.4
TkA02G473280	`PF22768`	SPP1_Dit	13	48	0.067	14.1
TkA02G473280	`PF10152`	CCDC53	18	116	0.086	14.0
TkA02G473280	`PF00428`	Ribosomal_60s	53	96	0.17	13.1
TkA02G473280	`PF22768`	SPP1_Dit	119	131	0.067	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card