TkA02G472950 | RubberDandelionOmics

Gene overview

TkA02G472950

Reference: TK1151 Chr: Chr02 Coordinates: 120676880-120677757 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA02G472950|TK1151|cDNA

ATGGTGGTTCGCAGCGTCGCCCGTGATTACTTGCCTCCAGAATTCCAAGACTACCTCTTTTACAGCTTCCGCACTTTCATCAACAAGTTCTTCACACACTTAACCATATCACCAAAAACCCTAGCGAGAAGAATATCAACGTTGCCATGGAAATCAAACGAGGAGGAGTTTACCGATGTTTACAACGGAGTCAAATTCACGTGGTCTTTGGATCTGGCGTTGAACGAGTACCTGCCGTTTATAATCCATGACGCGAAAAA...

CDS

Download CDS FASTA

573 bp · TkA02G472950|TK1151|CDS

ATGGTGGTTCGCAGCGTCGCCCGTGATTACTTGCCTCCAGAATTCCAAGACTACCTCTTTTACAGCTTCCGCACTTTCATCAACAAGTTCTTCACACACTTAACCATATCACCAAAAACCCTAGCGAGAAGAATATCAACGTTGCCATGGAAATCAAACGAGGAGGAGTTTACCGATGTTTACAACGGAGTCAAATTCACGTGGTCTTTGGATCTGGCGTTGAACGAGTACCTGCCGTTTATAATCCATGACGCGAAAAA...

Protein

Download Protein FASTA

190 aa · TkA02G472950|TK1151|PROTEIN

MVVRSVARDYLPPEFQDYLFYSFRTFINKFFTHLTISPKTLARRISTLPWKSNEEEFTDVYNGVKFTWSLDLALNEYLPFIIHDAKNEERTRENIEAIHHRYEDGVFRLPDGLYRGENITESRKSMEERLPVVWPPGRGKSSLIAAMANYLNFDIYDLELTDIKSNSELRRLLVATANRSILVVEDIDAR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G472950`
TK1151 ID	TkA02G472950
OH-1004 ID	LXL04_013772
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.500
Protein coverage (%)	TK1151 98.947 / OH-1004 29.268 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G472950

Location Chr02:120676880-120677757 (-)

Description Similar to HSR4: Protein HYPER-SENSITIVITY-RELATED 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50930`	Protein HYPER-SENSITIVITY-RELATED 4.	No verified direct reference in this release
`At5g17760`	AAA-ATPase At5g17760.	No verified direct reference in this release
`At3g50940`	AAA-ATPase At3g50940.	No verified direct reference in this release
`At4g25835`	AAA-ATPase At4g25835.	No verified direct reference in this release
`At4g30250`	AAA-ATPase At4g30250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013772 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006950 response to stress Biological Process

GO:0009411 response to UV Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT3G50930

ath:AT3G50940

ath:AT5G17760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.208

Rank 1 · TkA02G472950 · TK1151

Plastid0.205

Rank 2 · TkA02G472950 · TK1151

Nucleus0.148

Rank 3 · TkA02G472950 · TK1151

Endoplasmic reticulum0.127

Rank 4 · TkA02G472950 · TK1151

Extracellular0.113

Rank 5 · TkA02G472950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02757YLP7-13 aa

PF14363AAA_assoc11-35 aa

PF02757YLP16-19 aa

PF14363AAA_assoc53-70 aa

PF25684Mycobacteriophage_Gp5375-133 aa

PF02757YLP75-79 aa

PF17911Ski2_N86-127 aa

PF05496RuvB_N122-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G472950	`PF02757`	YLP	7	13	1.7	9.4
TkA02G472950	`PF14363`	AAA_assoc	11	35	0.0082	17.2
TkA02G472950	`PF02757`	YLP	16	19	1.7	9.4
TkA02G472950	`PF14363`	AAA_assoc	53	70	0.0082	17.2
TkA02G472950	`PF25684`	Mycobacteriophage_Gp53	75	133	0.049	13.9
TkA02G472950	`PF02757`	YLP	75	79	1.7	9.4
TkA02G472950	`PF17911`	Ski2_N	86	127	0.29	11.6
TkA02G472950	`PF05496`	RuvB_N	122	187	0.055	14.0
TkA02G472950	`PF00004`	AAA	135	189	4.9e-05	24.5
TkA02G472950	`PF14363`	AAA_assoc	150	156	0.0082	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZG2`	Arabidopsis thaliana	sp\|Q8VZG2\|HSR4_ARATH Protein HYPER-SENSITIVITY-RELATED 4	66.200%	Swiss-Prot	Low
`Q9FN75`	Arabidopsis thaliana	sp\|Q9FN75\|AATPI_ARATH AAA-ATPase At5g17760	44.100%	Swiss-Prot	Medium
`Q147F9`	Arabidopsis thaliana	sp\|Q147F9\|AATPC_ARATH AAA-ATPase At3g50940	41.000%	Swiss-Prot	Medium
`Q8RY66`	Arabidopsis thaliana	sp\|Q8RY66\|AATPD_ARATH AAA-ATPase At4g25835	74.100%	Swiss-Prot	Low
`F4JPK8`	Arabidopsis thaliana	sp\|F4JPK8\|AATPE_ARATH AAA-ATPase At4g30250	72.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card