TkA02G471880 | RubberDandelionOmics

Gene overview

TkA02G471880

Reference: TK1151 Chr: Chr02 Coordinates: 120409936-120417949 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

789 bp · TkA02G471880|TK1151|cDNA

ATACATTCCAACAATCATCAACTGTTTGCTTGCACATTTTGCATAATCACTTGTACCTTTAATATCTTTTTCACCGCAAGAAATGGCACAATACGGAGGAGAGCAGTACGGGCACAAGGAGGGTCACCACACCGACGAGCATGCCCACAACCCACTGCAGTCGACCGGCGTCGTAGGTCATGAAACCGAAGGTACAAAAATCAGTACCATCGGAACAGAGCCTGGTTACGTCCATGAACAAGGTAAACATAATGGTACCG...

CDS

Download CDS FASTA

444 bp · TkA02G471880|TK1151|CDS

ATGGCACAATACGGAGGAGAGCAGTACGGGCACAAGGAGGGTCACCACACCGACGAGCATGCCCACAACCCACTGCAGTCGACCGGCGTCGTAGGTCATGAAACCGAAGGTACAAAAATCAGTACCATCGGAACAGAGCCTGGTTACGTCCATGAACAAGGTAAACATAATGGTACCGGTACCGGTGACGGCGCCGGAGGCATCCTCCATCGTTCCGGGAGTGGAAGTTCAAGCTCTTCGGAGGATGATGGAGAGGGAGG...

Protein

Download Protein FASTA

147 aa · TkA02G471880|TK1151|PROTEIN

MAQYGGEQYGHKEGHHTDEHAHNPLQSTGVVGHETEGTKISTIGTEPGYVHEQGKHNGTGTGDGAGGILHRSGSGSSSSSEDDGEGGRRKKKGVAEKIKEKLPGGDEHQTSTPATVGGTGVGYKGDEGHEKKGVMDKIKEKLPGSHQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G471880`
TK1151 ID	TkA02G471880
OH-1004 ID	LXL04_013779
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G471880`
Location	Chr02:120409936-120417949 (-)
Description	Similar to RAB18: Dehydrin Rab18
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013779` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009961 response to 1-aminocyclopropane-1-carboxylic acid Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005507 copper ion binding Molecular Function GO:0016151 nickel cation binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT3G50980 ath:AT5G66400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · TkA02G471880 · TK1151

Cell membrane0.355

Rank 2 · TkA02G471880 · TK1151

Nucleus0.287

Rank 3 · TkA02G471880 · TK1151

Mitochondrion0.041

Rank 4 · TkA02G471880 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA02G471880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257Dehydrin14-146 aa

PF05642Sporozoite_P6735-104 aa

PF05642Sporozoite_P67106-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G471880	`PF00257`	Dehydrin	14	146	7.7e-32	111.6
TkA02G471880	`PF05642`	Sporozoite_P67	35	104	2.0	7.1
TkA02G471880	`PF05642`	Sporozoite_P67	106	145	2.0	7.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card