TkA02G471720 | RubberDandelionOmics

Gene overview

TkA02G471720

Reference: TK1151 Chr: Chr02 Coordinates: 120360745-120361482 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · TkA02G471720|TK1151|cDNA

ATGAAAAAAGACTATAATGTAACCCCACATGTAGACCACTACACATGCATGGTGGATCTTCTAGGAAGAGCTGGACACATCAATGATGCTTACAATCTCATAACCAAAATGACCATTTTACCCCACGCCGGCGTATGGGGAGCCTTACCTGGTGCATGTCGCATCCATAAAAACCCTAAAATAGCCGAAATTGCTGCAAATCATTTATTCAAACTCGAACCAAATGCTATAGGAAACTACATTCTTCTCTCAAACACTTA...

CDS

Download CDS FASTA

738 bp · TkA02G471720|TK1151|CDS

ATGAAAAAAGACTATAATGTAACCCCACATGTAGACCACTACACATGCATGGTGGATCTTCTAGGAAGAGCTGGACACATCAATGATGCTTACAATCTCATAACCAAAATGACCATTTTACCCCACGCCGGCGTATGGGGAGCCTTACCTGGTGCATGTCGCATCCATAAAAACCCTAAAATAGCCGAAATTGCTGCAAATCATTTATTCAAACTCGAACCAAATGCTATAGGAAACTACATTCTTCTCTCAAACACTTA...

Protein

Download Protein FASTA

245 aa · TkA02G471720|TK1151|PROTEIN

MKKDYNVTPHVDHYTCMVDLLGRAGHINDAYNLITKMTILPHAGVWGALPGACRIHKNPKIAEIAANHLFKLEPNAIGNYILLSNTYASAKKWNEVSRIRAMFRSKGLKKNPACSWVEGAKGVIQEFLAGDMVHPRSSEIKRELEDRLCKLRVDGYTPVLSCVTYDVSDDEKKRILLGHSEKLALAYGLLGDCGNIRIVKNIRICEDCHVVMCGASKVSGREIVVRDNMRFHSFRNGVCSCNNFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G471720`
TK1151 ID	TkA02G471720
OH-1004 ID	LXL04_013788
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 37.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G471720

Location Chr02:120360745-120361482 (+)

Description Similar to PCMP-H17: Pentatricopeptide repeat-containing protein At5g44230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44230`	Pentatricopeptide repeat-containing protein At5g44230.	No verified direct reference in this release
`At3g57430`	Involved in RNA editing events in chloroplasts.	A study of new Arabidopsis chloroplast RNA editing mutants reveals general features of editing factors and their target sites.2009 · DOI: 10.1105/tpc.109.071472
`At1g20230`	Pentatricopeptide repeat-containing protein At1g20230.	No verified direct reference in this release
`At4g33990`	Pentatricopeptide repeat-containing protein At4g33990.	No verified direct reference in this release
`At3g49142`	Putative pentatricopeptide repeat-containing protein At3g49142.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013788 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G29760

ath:AT3G49142

ath:AT5G06540

ath:AT5G44230

ath:AT5G66520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.434

Rank 1 · TkA02G471720 · TK1151

Plastid0.271

Rank 2 · TkA02G471720 · TK1151

Nucleus0.148

Rank 3 · TkA02G471720 · TK1151

Cytoplasm0.068

Rank 4 · TkA02G471720 · TK1151

Peroxisome0.013

Rank 5 · TkA02G471720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12854PPR_16-38 aa

PF13041PPR_210-37 aa

PF01535PPR13-37 aa

PF20431E_motif56-118 aa

PF20430Eplus_motif59-64 aa

PF01535PPR85-107 aa

PF20430Eplus_motif125-146 aa

PF14432DYW_deaminase155-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G471720	`PF12854`	PPR_1	6	38	0.00019	21.8
TkA02G471720	`PF13041`	PPR_2	10	37	0.048	14.5
TkA02G471720	`PF01535`	PPR	13	37	0.022	15.7
TkA02G471720	`PF20431`	E_motif	56	118	2.6e-20	73.1
TkA02G471720	`PF20430`	Eplus_motif	59	64	9.7e-06	26.0
TkA02G471720	`PF01535`	PPR	85	107	0.022	15.7
TkA02G471720	`PF20430`	Eplus_motif	125	146	9.7e-06	26.0
TkA02G471720	`PF14432`	DYW_deaminase	155	245	1.9e-37	127.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFG8`	Arabidopsis thaliana	sp\|Q9FFG8\|PP417_ARATH Pentatricopeptide repeat-containing protein At5g44230	56.300%	Swiss-Prot	High
`Q7Y211`	Arabidopsis thaliana	sp\|Q7Y211\|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic	47.200%	Swiss-Prot	Medium
`Q9LNU6`	Arabidopsis thaliana	sp\|Q9LNU6\|PPR53_ARATH Pentatricopeptide repeat-containing protein At1g20230	46.200%	Swiss-Prot	Medium
`O81767`	Arabidopsis thaliana	sp\|O81767\|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990	47.000%	Swiss-Prot	Medium
`P0C899`	Arabidopsis thaliana	sp\|P0C899\|PP271_ARATH Putative pentatricopeptide repeat-containing protein At3g49142	48.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card