TkA02G471680 | RubberDandelionOmics

Gene overview

TkA02G471680

Reference: TK1151 Chr: Chr02 Coordinates: 120343776-120344882 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · TkA02G471680|TK1151|cDNA

ATGAGAACTTGTCCAAGCCATGAAGTCATTTTTCCTAAAGAAGATGATGGCTTTTCTTTTCCCAACCATTTCACTCAGCTCGATTTCAGGTTTCCGGAGAGAGGATGCAACCTTACATACGATTTGCCCCCGATGCCACCTCAGCATAATGGATTTGACGTGCTTCCATGGATGGACATGATCATCTCAAGGGACCCATTGTATTCATCTTTAGATATCGTACCAAGTCACAACCAATGTCTTCTTCCAGAGTATTTCAC...

CDS

Download CDS FASTA

828 bp · TkA02G471680|TK1151|CDS

ATGAGAACTTGTCCAAGCCATGAAGTCATTTTTCCTAAAGAAGATGATGGCTTTTCTTTTCCCAACCATTTCACTCAGCTCGATTTCAGGTTTCCGGAGAGAGGATGCAACCTTACATACGATTTGCCCCCGATGCCACCTCAGCATAATGGATTTGACGTGCTTCCATGGATGGACATGATCATCTCAAGGGACCCATTGTATTCATCTTTAGATATCGTACCAAGTCACAACCAATGTCTTCTTCCAGAGTATTTCAC...

Protein

Download Protein FASTA

275 aa · TkA02G471680|TK1151|PROTEIN

MRTCPSHEVIFPKEDDGFSFPNHFTQLDFRFPERGCNLTYDLPPMPPQHNGFDVLPWMDMIISRDPLYSSLDIVPSHNQCLLPEYFTNGTPADDQFMHVYGINNEFNSYNQDYICGFQNHQDPPLMITYTEDDHNNNGVQVTKENVEKMELKMEITNPKTLEKERHLNGSNAGGSNSNYTSKMMLSRETISKYFYMPITQAAKELNVGITLLKKRCRELGIRRWPHRKLMSLQNVINNVQQELGKSSGERADGKLREAIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G471680`
TK1151 ID	TkA02G471680
OH-1004 ID	LXL04_008649
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 97.455 / OH-1004 73.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G471680

Location Chr02:120343776-120344882 (-)

Description Similar to RKD1: Protein RKD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18790`	Putative transcription factor.	No verified direct reference in this release
`At1g74480`	Putative transcription factor.	No verified direct reference in this release
`At5g66990`	Putative transcription factor.	No verified direct reference in this release
`At5g53040`	Putative transcription factor.	No verified direct reference in this release
`At4g35590`	Putative transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008649 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G18790

ath:AT1G74480

ath:AT4G35590

ath:AT5G53040

ath:AT5G66990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA02G471680 · TK1151

Cytoplasm0.086

Rank 2 · TkA02G471680 · TK1151

Cell membrane0.029

Rank 3 · TkA02G471680 · TK1151

Endoplasmic reticulum0.023

Rank 4 · TkA02G471680 · TK1151

Plastid0.014

Rank 5 · TkA02G471680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07106WHD_TBPIP139-148 aa

PF02042RWP-RK181-266 aa

PF07106WHD_TBPIP230-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G471680	`PF07106`	WHD_TBPIP	139	148	0.18	12.5
TkA02G471680	`PF02042`	RWP-RK	181	266	2.1e-26	92.6
TkA02G471680	`PF07106`	WHD_TBPIP	230	269	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9U9`	Arabidopsis thaliana	sp\|Q9M9U9\|RKD1_ARATH Protein RKD1	70.700%	Swiss-Prot	Low
`Q9CA66`	Arabidopsis thaliana	sp\|Q9CA66\|RKD2_ARATH Protein RKD2	67.100%	Swiss-Prot	Low
`Q9FGD1`	Arabidopsis thaliana	sp\|Q9FGD1\|RKD3_ARATH Protein RKD3	61.000%	Swiss-Prot	Low
`Q9LVU8`	Arabidopsis thaliana	sp\|Q9LVU8\|RKD4_ARATH Protein RKD4	62.500%	Swiss-Prot	Low
`O81791`	Arabidopsis thaliana	sp\|O81791\|RKD5_ARATH Protein RKD5	54.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card