TkA02G471160 | RubberDandelionOmics

Gene overview

TkA02G471160

Reference: TK1151 Chr: Chr02 Coordinates: 120210921-120214686 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2752 bp · TkA02G471160|TK1151|cDNA

TGCATCCTTAAAAAATCTAAAAAAACACAAACGACAGAATCCCCAACATAAATAAAATATTTCAAAAAGGCGAAGTAAAAATCTGCTACTCCTTCTCTTGTAGAAACTCAGTGGTTTGGTTCGAGAGTGACGTTACCGCGCGATGAGCTTTGACAAGATTTTCGCATTCCGCTCCCTCTCGATGCTGCTACTCTGAGCTTCTCCTTCGAAATCCTCTACAAATTTCACTCATTTTCGGAAAAATTCGACATCTGTAACTC...

CDS

Download CDS FASTA

2286 bp · TkA02G471160|TK1151|CDS

ATGACAGCAACGGCTTCTGTTTCTTCTCCATGGATTCCTGAAGATGACCTGTTGCTTAAGAATTCAATCGAGGGTGGAGCTTCACTGGAAGCACTTGCAAAAGGGGCAGTAAAATTTTCCCGCAGATTTACCTTCCGTGAAATTCGAGATCGATGGTATTCTCTTCTCTATGACCCCGATGTGTCAGCTCAAGCTTCTGCCCGCATGGCTGAGCTGGAACTCTCTGGTAATTCCAATCCACCATCAAAATTAAAACCAGA...

Protein

Download Protein FASTA

761 aa · TkA02G471160|TK1151|PROTEIN

MTATASVSSPWIPEDDLLLKNSIEGGASLEALAKGAVKFSRRFTFREIRDRWYSLLYDPDVSAQASARMAELELSGNSNPPSKLKPDTTKPTDKVPEKRKSGSIRKHYHSWRKRIKNDYFSSQNLPFYEDRKTNHDAPGGSDGMLDLGFEEKDFEILRQAFPESIGSIAIATTTTTTTTTVIDNNQTNTFHMERCNHKYNHNHNHNQKSVENDYMNGSMREEEEEEEEEEGDLFNVSSPSRNMDPNIEMKNATCTSETPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G471160`
TK1151 ID	TkA02G471160
OH-1004 ID	LXL04_013799
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G471160`
Location	Chr02:120210921-120214686 (-)
Description	Similar to MCRS1: Microspherule protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013799` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0033044 regulation of chromosome organization Biological Process GO:0036211 protein modification process Biological Process GO:0045739 positive regulation of DNA repair Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process
KEGG gene cross-reference	hsa:10445 mmu:51812 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA02G471160 · TK1151

Cytoplasm0.100

Rank 2 · TkA02G471160 · TK1151

Cell membrane0.028

Rank 3 · TkA02G471160 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA02G471160 · TK1151

Plastid0.012

Rank 5 · TkA02G471160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13325MCRS_N11-73 aa

PF13325MCRS_N166-203 aa

PF05642Sporozoite_P67168-278 aa

PF13325MCRS_N591-636 aa

PF27851CHP_AF_0576658-701 aa

PF00498FHA669-741 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G471160	`PF13325`	MCRS_N	11	73	2.3e-19	70.8
TkA02G471160	`PF13325`	MCRS_N	166	203	2.3e-19	70.8
TkA02G471160	`PF05642`	Sporozoite_P67	168	278	0.21	10.3
TkA02G471160	`PF13325`	MCRS_N	591	636	2.3e-19	70.8
TkA02G471160	`PF27851`	CHP_AF_0576	658	701	0.2	12.2
TkA02G471160	`PF00498`	FHA	669	741	7.3e-08	33.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card