TkA02G469650 | RubberDandelionOmics

Gene overview

TkA02G469650

Reference: TK1151 Chr: Chr02 Coordinates: 119802815-119805158 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · TkA02G469650|TK1151|cDNA

TGTAATTTGTGTTTCCGAGTTAGGAGAGAAATGGAAGGAAAATTAATCACTTTGTTCATTTCTCTCCAAATCCGTCCAAATTAGAAGGAAAGTTAGGAGGGAAAGTTATCATTCCACTTCCTTTCATTTCCTTCCAAATCATTTCATTTAAACTCAGGAACACGAAATGTTTTTTTTATTTTCCTCTCTTTTCCACCCATTTCCTTTCCTTTCCCTCGATAAATTAAACTCGGGAACAAGGTTTTAGCAAGGGGATCGGC...

CDS

Download CDS FASTA

954 bp · TkA02G469650|TK1151|CDS

ATGGAGAACGGTAGAAAGGCATCGTCATTAAGGTGGGGAATCCTTCGTCGAGCCCTAATCCCTTCTAGTTCGTCCACTGGTCCAGATGAGCAATCTGAAAAAGGTATCAGGAATATTTCCAGAAAGGCTAATCAAGGGTTCAGTTTGATACCCTTCCGGTTAGTGGATAAACCCAAGCTTGAGCACAAAGAAGTAATCCCCACTTCATCGCCAAATGCCACAGAAGCTTGTGTGTGCTATACATTGCCCAATCACAGTGC...

Protein

Download Protein FASTA

317 aa · TkA02G469650|TK1151|PROTEIN

MENGRKASSLRWGILRRALIPSSSSTGPDEQSEKGIRNISRKANQGFSLIPFRLVDKPKLEHKEVIPTSSPNATEACVCYTLPNHSATELFLYQRVDTSANLDDFKICNTYDIDNTGLVCSWPSEEVLAYYCLSQIDLFRSKRVIELGSGYGLAGLLIASVTDALEVVISDGNPQVVDYIQRNINANLRHFNNTKVKSMMLHWNHEELSDISNNFDIIVASDCTFFKEFHKGLVQTVKCLLKKQGPSEAIFLGPKRGNSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G469650`
TK1151 ID	TkA02G469650
OH-1004 ID	LXL04_013824
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G469650

Location Chr02:119802815-119805158 (+)

Description Similar to CaMKMT: Calmodulin-lysine N-methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35987`	Catalyzes the trimethylation of calmodulin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013824 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006479 protein methylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009630 gravitropism Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT4G35987

hsa:79823

mmu:73582

rno:299521

xla:443973

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · TkA02G469650 · TK1151

Nucleus0.515

Rank 2 · TkA02G469650 · TK1151

Mitochondrion0.060

Rank 3 · TkA02G469650 · TK1151

Cell membrane0.044

Rank 4 · TkA02G469650 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA02G469650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10294Methyltransf_16122-268 aa

PF06325PrmA132-220 aa

PF02527GidB132-200 aa

PF05175MTS135-194 aa

PF13489Methyltransf_23138-245 aa

PF13847Methyltransf_31141-244 aa

PF02475TRM5-TYW2_MTfase142-231 aa

PF13649Methyltransf_25144-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G469650	`PF10294`	Methyltransf_16	122	268	8.4e-23	81.7
TkA02G469650	`PF06325`	PrmA	132	220	0.0072	16.6
TkA02G469650	`PF02527`	GidB	132	200	0.027	14.5
TkA02G469650	`PF05175`	MTS	135	194	1.1e-05	25.8
TkA02G469650	`PF13489`	Methyltransf_23	138	245	0.082	13.3
TkA02G469650	`PF13847`	Methyltransf_31	141	244	0.02	15.4
TkA02G469650	`PF02475`	TRM5-TYW2_MTfase	142	231	0.025	15.2
TkA02G469650	`PF13649`	Methyltransf_25	144	245	0.00021	22.6
TkA02G469650	`PF08242`	Methyltransf_12	145	244	0.0099	17.3
TkA02G469650	`PF08241`	Methyltransf_11	146	245	0.078	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JNX3`	Arabidopsis thaliana	sp\|F4JNX3\|CMKMT_ARATH Calmodulin-lysine N-methyltransferase	56.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card