TkA02G469090 | RubberDandelionOmics

Gene overview

TkA02G469090

Reference: TK1151 Chr: Chr02 Coordinates: 119632593-119635658 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1065 bp · TkA02G469090|TK1151|cDNA

GTTTGTAGCCTAATCCTCTCTGTTGCTGCCATGTTATATTTATGTAGGAAAAAGAAATTTTTAGCGGGGTTCAAACGTCGAATGGAGTATATGAAAGATAAGATTGATGCTCATGAGCTTATGCTGAGGAAATTTCAACTTGAAGAGCTTGAGAATGCTACCAATCATTTTGCAAAAGAGTGTTTGGTAGGATCTGGTGCGTTTGGAAACGTGTACAAAGGAACTTTCCAAGGAGATATAACTCTAGCAATCAAGAAGGC...

CDS

Download CDS FASTA

1035 bp · TkA02G469090|TK1151|CDS

ATGTTATATTTATGTAGGAAAAAGAAATTTTTAGCGGGGTTCAAACGTCGAATGGAGTATATGAAAGATAAGATTGATGCTCATGAGCTTATGCTGAGGAAATTTCAACTTGAAGAGCTTGAGAATGCTACCAATCATTTTGCAAAAGAGTGTTTGGTAGGATCTGGTGCGTTTGGAAACGTGTACAAAGGAACTTTCCAAGGAGATATAACTCTAGCAATCAAGAAGGCCCGTGACGATTCCTACACAAGCATACAAGA...

Protein

Download Protein FASTA

345 aa · TkA02G469090|TK1151|PROTEIN

MLYLCRKKKFLAGFKRRMEYMKDKIDAHELMLRKFQLEELENATNHFAKECLVGSGAFGNVYKGTFQGDITLAIKKARDDSYTSIQEFRNEIKLLSRVKHRNLVGLVGYCEETGMKGVQILVYEYVPNGSLLEHIVGRGREPLTWRQRVNIAIQAAKGIAHLHEGIKPSIIHRDIKPSNILIGDGFEAKVSDFGLVRSGPVGDNSYVSSQIKGTPGYLDPAYCTSFHLSQFSDVYSFGVILLQLIAARPAVDSNRSRASY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G469090`
TK1151 ID	TkA02G469090
OH-1004 ID	LXL04_016453
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.100
Protein coverage (%)	TK1151 84.638 / OH-1004 35.424 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G469090

Location Chr02:119632593-119635658 (+)

Description Similar to THE1: Receptor-like protein kinase THESEUS 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21480

ath:AT3G46290

ath:AT5G54380

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.732

Rank 1 · TkA02G469090 · TK1151

Cytoplasm0.214

Rank 2 · TkA02G469090 · TK1151

Nucleus0.163

Rank 3 · TkA02G469090 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA02G469090 · TK1151

Golgi apparatus0.029

Rank 5 · TkA02G469090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC138-96 aa

PF00069Pkinase49-319 aa

PF07714PK_Tyr_Ser-Thr52-321 aa

PF01636APH71-164 aa

PF01636APH160-200 aa

PF03109ABC1160-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G469090	`PF03109`	ABC1	38	96	0.0068	16.3
TkA02G469090	`PF00069`	Pkinase	49	319	3.5e-39	135.5
TkA02G469090	`PF07714`	PK_Tyr_Ser-Thr	52	321	1.9e-39	136.2
TkA02G469090	`PF01636`	APH	71	164	0.0013	19.3
TkA02G469090	`PF01636`	APH	160	200	0.0013	19.3
TkA02G469090	`PF03109`	ABC1	160	198	0.0068	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK35`	Arabidopsis thaliana	sp\|Q9LK35\|THE1_ARATH Receptor-like protein kinase THESEUS 1	43.200%	Swiss-Prot	Medium
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	41.600%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	41.300%	Swiss-Prot	Medium
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	41.600%	Swiss-Prot	Medium
`P43293`	Arabidopsis thaliana	sp\|P43293\|PBL11_ARATH Probable serine/threonine-protein kinase PBL11	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card