TkA02G467410 | RubberDandelionOmics

Gene overview

TkA02G467410

Reference: TK1151 Chr: Chr02 Coordinates: 119221612-119223860 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · TkA02G467410|TK1151|cDNA

CACTCTCCGTTGTGGGTCCTCGCACCACGCCACGTCCCTTTTTATAATTCTTTTCGACCGTTGCGCACAAAATCCCATACAAATCCCTCTTTCTCTTTCTGTTTCTCTATCTCTCCCTTCCTCTCAACGCACCGCCATTGCAAGATGAGCAGCACTGCAGTAGCCAAAAGCCATTGGAAGAAGGTTGCCAAGGTCACTCTTGGTCTGTTTTTCCGAGGCTTCAACACCTCCAAATGCAAGACGGCGGCGAAATTGGCGGT...

CDS

Download CDS FASTA

1446 bp · TkA02G467410|TK1151|CDS

CACTCTCCGTTGTGGGTCCTCGCACCACGCCACGTCCCTTTTTATAATTCTTTTCGACCGTTGCGCACAAAATCCCATACAAATCCCTCTTTCTCTTTCTGTTTCTCTATCTCTCCCTTCCTCTCAACGCACCGCCATTGCAAGATGAGCAGCACTGCAGTAGCCAAAAGCCATTGGAAGAAGGTTGCCAAGGTCACTCTTGGTCTGTTTTTCCGAGGCTTCAACACCTCCAAATGCAAGACGGCGGCGAAATTGGCGGT...

Protein

Download Protein FASTA

481 aa · TkA02G467410|TK1151|PROTEIN

HSPLWVLAPRHVPFYNSFRPLRTKSHTNPSFSFCFSISPFLSTHRHCKMSSTAVAKSHWKKVAKVTLGLFFRGFNTSKCKTAAKLAVARIKLLRNKRQVVVRQMRRDIAMLLQSGQDATARIRVEHVLREQNILAANEFIELFCELIVQRLTIIAKQKDCPADLKEGISSLIFAAPRCSEIPELVALRDIFEKKYGKDFIGAATDLRPDCGVNRMLIEKLSVKTPAGEVKLKVLKEIAKEYQVDWDTTESETELLKPPEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G467410`
TK1151 ID	TkA02G467410
OH-1004 ID	LXL04_031195
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	58.800
Protein coverage (%)	TK1151 43.659 / OH-1004 44.397 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G467410`
Location	Chr02:119221612-119223860 (+)
Description	Similar to DDB_G0289029: IST1-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031195` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008104 intracellular protein localization Biological Process GO:0015031 protein transport Biological Process GO:0036258 multivesicular body assembly Biological Process GO:0045184 establishment of protein localization Biological Process GO:0045862 positive regulation of proteolysis Biological Process GO:0051301 cell division Biological Process GO:0061640 cytoskeleton-dependent cytokinesis Biological Process GO:0061952 midbody abscission Biological Process GO:1904903 ESCRT III complex disassembly Biological Process GO:0000785 chromatin Cellular Component GO:0005576 extracellular region Cellular Component GO:0005635 nuclear envelope Cellular Component
KEGG gene cross-reference	bta:508900 ddi:DDB_G0289029 hsa:9798 mmu:71955 rno:307833 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.435

Rank 1 · TkA02G467410 · TK1151

Cytoplasm0.358

Rank 2 · TkA02G467410 · TK1151

Nucleus0.277

Rank 3 · TkA02G467410 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA02G467410 · TK1151

Golgi apparatus0.055

Rank 5 · TkA02G467410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03398Ist180-244 aa

PF20822Cmr2_hel_dom1187-220 aa

PF14999Shadoo290-345 aa

PF20822Cmr2_hel_dom1349-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G467410	`PF03398`	Ist1	80	244	5.6e-62	209.2
TkA02G467410	`PF20822`	Cmr2_hel_dom1	187	220	0.044	15.0
TkA02G467410	`PF14999`	Shadoo	290	345	0.37	11.6
TkA02G467410	`PF20822`	Cmr2_hel_dom1	349	402	0.044	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card